Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1064294..1064951 | Replicon | chromosome |
Accession | NZ_OU963893 | ||
Organism | Unidentified bacterial endosymbiont isolate Enterobacter_chilo |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NL510_RS05080 | Protein ID | WP_253382143.1 |
Coordinates | 1064541..1064951 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NL510_RS05075 | Protein ID | WP_253382141.1 |
Coordinates | 1064294..1064560 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL510_RS05050 | 1059529..1059711 | + | 183 | Protein_979 | NAD(P)-dependent oxidoreductase | - |
NL510_RS05055 | 1059767..1061200 | - | 1434 | WP_253382135.1 | 6-phospho-beta-glucosidase | - |
NL510_RS05060 | 1061317..1062048 | - | 732 | WP_253384755.1 | MurR/RpiR family transcriptional regulator | - |
NL510_RS05065 | 1062314..1062973 | + | 660 | WP_253382137.1 | hemolysin III family protein | - |
NL510_RS05070 | 1063019..1063999 | - | 981 | WP_253382139.1 | tRNA-modifying protein YgfZ | - |
NL510_RS05075 | 1064294..1064560 | + | 267 | WP_253382141.1 | FAD assembly factor SdhE | Antitoxin |
NL510_RS05080 | 1064541..1064951 | + | 411 | WP_253382143.1 | protein YgfX | Toxin |
NL510_RS05085 | 1064957..1065478 | - | 522 | WP_253382146.1 | flavodoxin FldB | - |
NL510_RS05090 | 1065580..1066476 | + | 897 | WP_253384758.1 | site-specific tyrosine recombinase XerD | - |
NL510_RS05095 | 1066505..1067218 | + | 714 | WP_253382148.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL510_RS05100 | 1067224..1068957 | + | 1734 | WP_253382150.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16148.01 Da Isoelectric Point: 11.8921
>T294951 WP_253382143.1 NZ_OU963893:1064541-1064951 [unidentified bacterial endosymbiont]
VVLWQSDLRVSWRSQWMSLMLHGVVAALVLLMPWPLSYTPVWLLMLSFVVFDSVRSQRRINARQGEIKLLVDSRLRWQGK
EWEIVGMPWMLRSGMMLRLRNAGGGRRQHLWLASDSMDIAEWRDLRRTFLQQPTQE
VVLWQSDLRVSWRSQWMSLMLHGVVAALVLLMPWPLSYTPVWLLMLSFVVFDSVRSQRRINARQGEIKLLVDSRLRWQGK
EWEIVGMPWMLRSGMMLRLRNAGGGRRQHLWLASDSMDIAEWRDLRRTFLQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|