Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1390029..1390649 | Replicon | chromosome |
Accession | NZ_OU943338 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain MDUST348 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | AFF66_RS06780 | Protein ID | WP_001280991.1 |
Coordinates | 1390029..1390247 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | AFF66_RS06785 | Protein ID | WP_000344807.1 |
Coordinates | 1390275..1390649 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AFF66_RS06740 (SAMEA2158835_01366) | 1385252..1385821 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
AFF66_RS06745 (SAMEA2158835_01367) | 1385854..1386243 | - | 390 | WP_000961285.1 | MGMT family protein | - |
AFF66_RS06755 (SAMEA2158835_01368) | 1386474..1388024 | - | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
AFF66_RS06760 (SAMEA2158835_01369) | 1388249..1388509 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
AFF66_RS06765 | 1388515..1388655 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
AFF66_RS06770 (SAMEA2158835_01370) | 1388711..1389181 | - | 471 | WP_000136183.1 | YlaC family protein | - |
AFF66_RS06775 (SAMEA2158835_01371) | 1389299..1389850 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
AFF66_RS06780 (SAMEA2158835_01372) | 1390029..1390247 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
AFF66_RS06785 (SAMEA2158835_01373) | 1390275..1390649 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
AFF66_RS06790 (SAMEA2158835_01374) | 1391145..1394294 | - | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
AFF66_RS06795 (SAMEA2158835_01375) | 1394317..1395510 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T294939 WP_001280991.1 NZ_OU943338:c1390247-1390029 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT294939 WP_000344807.1 NZ_OU943338:c1390649-1390275 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|