Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 821847..822472 | Replicon | chromosome |
Accession | NZ_OU943338 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain MDUST348 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | AFF66_RS04030 | Protein ID | WP_000911334.1 |
Coordinates | 822074..822472 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | AFF66_RS04025 | Protein ID | WP_000557549.1 |
Coordinates | 821847..822074 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AFF66_RS03995 (SAMEA2158835_00815) | 817040..817759 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
AFF66_RS04000 (SAMEA2158835_00816) | 817763..817966 | + | 204 | WP_000184036.1 | hypothetical protein | - |
AFF66_RS04005 (SAMEA2158835_00817) | 818049..818504 | + | 456 | WP_223229661.1 | hypothetical protein | - |
AFF66_RS04010 (SAMEA2158835_00818) | 818606..819727 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
AFF66_RS04015 (SAMEA2158835_00819) | 820338..821144 | - | 807 | WP_077942019.1 | DUF1460 domain-containing protein | - |
AFF66_RS04020 (SAMEA2158835_00820) | 821419..821670 | - | 252 | WP_001540858.1 | hypothetical protein | - |
AFF66_RS04025 (SAMEA2158835_00821) | 821847..822074 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
AFF66_RS04030 (SAMEA2158835_00822) | 822074..822472 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
AFF66_RS04035 (SAMEA2158835_00824) | 823279..823815 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
AFF66_RS04040 (SAMEA2158835_00825) | 823862..824494 | + | 633 | WP_000835268.1 | YfdX family protein | - |
AFF66_RS04045 (SAMEA2158835_00826) | 825213..825794 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 814788..832365 | 17577 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T294937 WP_000911334.1 NZ_OU943338:822074-822472 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|