Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4695803..4696419 Replicon chromosome
Accession NZ_OU943337
Organism Salmonella enterica subsp. enterica serovar Typhi strain MDUST255

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag AE465_RS23145 Protein ID WP_000238494.1
Coordinates 4695803..4696177 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag AE465_RS23150 Protein ID WP_001523745.1
Coordinates 4696177..4696419 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AE465_RS23130 (SAMEA2145578_04645) 4693305..4694207 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
AE465_RS23135 (SAMEA2145578_04646) 4694204..4694839 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
AE465_RS23140 (SAMEA2145578_04647) 4694836..4695765 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
AE465_RS23145 (SAMEA2145578_04648) 4695803..4696177 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
AE465_RS23150 (SAMEA2145578_04649) 4696177..4696419 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
AE465_RS23155 (SAMEA2145578_04650) 4696624..4697553 + 930 WP_001162859.1 alpha/beta hydrolase -
AE465_RS23160 (SAMEA2145578_04651) 4697639..4697950 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
AE465_RS23165 (SAMEA2145578_04652) 4697947..4698393 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
AE465_RS23170 (SAMEA2145578_04653) 4698408..4699349 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
AE465_RS23175 (SAMEA2145578_04654) 4699394..4699831 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
AE465_RS23180 (SAMEA2145578_04655) 4699828..4700700 - 873 WP_000921423.1 virulence factor BrkB family protein -
AE465_RS23185 (SAMEA2145578_04656) 4700694..4701293 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T294933 WP_000238494.1 NZ_OU943337:c4696177-4695803 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT294933 WP_001523745.1 NZ_OU943337:c4696419-4696177 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References