Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3341719..3342339 | Replicon | chromosome |
Accession | NZ_OU943337 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain MDUST255 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | AE465_RS16590 | Protein ID | WP_001280991.1 |
Coordinates | 3342121..3342339 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | AE465_RS16585 | Protein ID | WP_000344807.1 |
Coordinates | 3341719..3342093 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AE465_RS16575 (SAMEA2145578_03334) | 3336858..3338051 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
AE465_RS16580 (SAMEA2145578_03335) | 3338074..3341223 | + | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
AE465_RS16585 (SAMEA2145578_03336) | 3341719..3342093 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
AE465_RS16590 (SAMEA2145578_03337) | 3342121..3342339 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
AE465_RS16595 (SAMEA2145578_03338) | 3342518..3343069 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
AE465_RS16600 (SAMEA2145578_03339) | 3343187..3343657 | + | 471 | WP_000136183.1 | YlaC family protein | - |
AE465_RS16605 | 3343713..3343853 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
AE465_RS16610 (SAMEA2145578_03340) | 3343859..3344119 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
AE465_RS16615 (SAMEA2145578_03341) | 3344344..3345894 | + | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
AE465_RS16625 (SAMEA2145578_03342) | 3346125..3346514 | + | 390 | WP_000961285.1 | MGMT family protein | - |
AE465_RS16630 (SAMEA2145578_03343) | 3346547..3347116 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T294928 WP_001280991.1 NZ_OU943337:3342121-3342339 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT294928 WP_000344807.1 NZ_OU943337:3341719-3342093 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|