Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4518112..4518728 | Replicon | chromosome |
Accession | NZ_OU943336 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain MDUST305 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q8Z2U3 |
Locus tag | AEG13_RS22280 | Protein ID | WP_000238494.1 |
Coordinates | 4518112..4518486 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8E9YHE9 |
Locus tag | AEG13_RS22285 | Protein ID | WP_001523745.1 |
Coordinates | 4518486..4518728 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AEG13_RS22265 (SAMEA1964467_04457) | 4515614..4516516 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
AEG13_RS22270 (SAMEA1964467_04458) | 4516513..4517148 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
AEG13_RS22275 (SAMEA1964467_04459) | 4517145..4518074 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
AEG13_RS22280 (SAMEA1964467_04460) | 4518112..4518486 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
AEG13_RS22285 (SAMEA1964467_04461) | 4518486..4518728 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | Antitoxin |
AEG13_RS22290 (SAMEA1964467_04462) | 4518933..4519862 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
AEG13_RS22295 (SAMEA1964467_04463) | 4519948..4520259 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | - |
AEG13_RS22300 (SAMEA1964467_04464) | 4520256..4520702 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
AEG13_RS22305 (SAMEA1964467_04465) | 4520717..4521658 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
AEG13_RS22310 (SAMEA1964467_04466) | 4521703..4522140 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
AEG13_RS22315 (SAMEA1964467_04467) | 4522137..4523009 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
AEG13_RS22320 (SAMEA1964467_04468) | 4523003..4523602 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13908.18 Da Isoelectric Point: 7.3567
>T294918 WP_000238494.1 NZ_OU943336:c4518486-4518112 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|