Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3341854..3342474 | Replicon | chromosome |
Accession | NZ_OU943336 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain MDUST305 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | AEG13_RS16685 | Protein ID | WP_001280991.1 |
Coordinates | 3342256..3342474 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | AEG13_RS16680 | Protein ID | WP_000344807.1 |
Coordinates | 3341854..3342228 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AEG13_RS16670 (SAMEA1964467_03330) | 3336993..3338186 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
AEG13_RS16675 (SAMEA1964467_03331) | 3338209..3341358 | + | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
AEG13_RS16680 (SAMEA1964467_03332) | 3341854..3342228 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
AEG13_RS16685 (SAMEA1964467_03333) | 3342256..3342474 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
AEG13_RS16690 (SAMEA1964467_03334) | 3342653..3343204 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
AEG13_RS16695 (SAMEA1964467_03335) | 3343322..3343792 | + | 471 | WP_000136183.1 | YlaC family protein | - |
AEG13_RS16700 | 3343848..3343988 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
AEG13_RS16705 (SAMEA1964467_03336) | 3343994..3344254 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
AEG13_RS16710 (SAMEA1964467_03337) | 3344479..3346029 | + | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
AEG13_RS16720 (SAMEA1964467_03338) | 3346260..3346649 | + | 390 | WP_000961285.1 | MGMT family protein | - |
AEG13_RS16725 (SAMEA1964467_03339) | 3346682..3347251 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T294913 WP_001280991.1 NZ_OU943336:3342256-3342474 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT294913 WP_000344807.1 NZ_OU943336:3341854-3342228 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|