Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 1703955..1704997 Replicon chromosome
Accession NZ_OU943334
Organism Stenotrophomonas maltophilia isolate Stenotrophomonas maltophilia 1800

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag LNN95_RS08085 Protein ID WP_014747691.1
Coordinates 1704494..1704997 (+) Length 168 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag LNN95_RS08080 Protein ID WP_003050245.1
Coordinates 1703955..1704425 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNN95_RS08045 (STEN1800_1678) 1699347..1700765 - 1419 WP_003109776.1 TIGR03752 family integrating conjugative element protein -
LNN95_RS08050 (STEN1800_1679) 1700755..1701666 - 912 WP_003105643.1 TIGR03749 family integrating conjugative element protein -
LNN95_RS08055 (STEN1800_1680) 1701663..1702355 - 693 WP_003105641.1 TIGR03746 family integrating conjugative element protein -
LNN95_RS08060 (STEN1800_1681) 1702352..1702750 - 399 WP_003105639.1 TIGR03750 family conjugal transfer protein -
LNN95_RS08065 (STEN1800_1682) 1702762..1703121 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
LNN95_RS08070 (STEN1800_1683) 1703138..1703371 - 234 WP_003050225.1 TIGR03758 family integrating conjugative element protein -
LNN95_RS08075 (STEN1800_1684) 1703368..1703751 - 384 WP_003105635.1 RAQPRD family integrative conjugative element protein -
LNN95_RS08080 (STEN1800_1685) 1703955..1704425 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
LNN95_RS08085 (STEN1800_1686) 1704494..1704997 + 504 WP_014747691.1 PIN domain-containing protein Toxin
LNN95_RS08090 (STEN1800_1687) 1705015..1705929 + 915 WP_228355208.1 AAA family ATPase -
LNN95_RS08095 (STEN1800_1688) 1705926..1706396 + 471 WP_003105626.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
LNN95_RS08100 (STEN1800_1689) 1706393..1706893 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
LNN95_RS08105 (STEN1800_1690) 1706893..1707795 + 903 WP_003105624.1 CBASS oligonucleotide cyclase -
LNN95_RS08110 (STEN1800_1691) 1707834..1708559 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1659643..1753805 94162


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-90)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 168 a.a.        Molecular weight: 18879.55 Da        Isoelectric Point: 5.2622

>T294904 WP_014747691.1 NZ_OU943334:1704494-1704997 [Stenotrophomonas maltophilia]
MWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGYEALVAGLTLPDPDDRHVLAAAIRC
GASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKHPPIEVDRYLEILLRQGLVQTTKVL
ATYRTIL

Download         Length: 504 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT294904 WP_003050245.1 NZ_OU943334:1703955-1704425 [Stenotrophomonas maltophilia]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References