Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 299521..300169 | Replicon | chromosome |
Accession | NZ_OU943334 | ||
Organism | Stenotrophomonas maltophilia isolate Stenotrophomonas maltophilia 1800 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A0L8AET4 |
Locus tag | LNN95_RS01370 | Protein ID | WP_010486984.1 |
Coordinates | 299521..299808 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | LNN95_RS01375 | Protein ID | WP_099559694.1 |
Coordinates | 299867..300169 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNN95_RS01345 (STEN1800_0285) | 294719..295450 | + | 732 | WP_197656828.1 | type III pantothenate kinase | - |
LNN95_RS01350 (STEN1800_0286) | 295460..296308 | + | 849 | WP_197656827.1 | SPOR domain-containing protein | - |
LNN95_RS01360 (STEN1800_0289) | 297537..298661 | - | 1125 | WP_228355032.1 | hypothetical protein | - |
LNN95_RS01365 (STEN1800_0290) | 298689..299288 | - | 600 | WP_197656826.1 | hypothetical protein | - |
LNN95_RS01370 (STEN1800_0292) | 299521..299808 | + | 288 | WP_010486984.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LNN95_RS01375 (STEN1800_0293) | 299867..300169 | + | 303 | WP_099559694.1 | putative addiction module antidote protein | Antitoxin |
LNN95_RS01380 (STEN1800_0294) | 300226..300549 | - | 324 | WP_197656825.1 | hypothetical protein | - |
LNN95_RS01385 (STEN1800_0295) | 300630..301037 | - | 408 | WP_228355033.1 | hypothetical protein | - |
LNN95_RS01390 (STEN1800_0296) | 301632..302402 | + | 771 | WP_197656823.1 | DUF3011 domain-containing protein | - |
LNN95_RS01395 (STEN1800_0297) | 302427..302813 | - | 387 | WP_228355034.1 | hypothetical protein | - |
LNN95_RS01400 (STEN1800_0298) | 302904..303824 | + | 921 | WP_043401829.1 | arginase | - |
LNN95_RS01405 (STEN1800_0299) | 303987..304124 | + | 138 | WP_014035659.1 | entericidin A/B family lipoprotein | - |
LNN95_RS01410 (STEN1800_0300) | 304327..304548 | + | 222 | WP_004137109.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 287765..301037 | 13272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10744.34 Da Isoelectric Point: 10.8940
>T294903 WP_010486984.1 NZ_OU943334:299521-299808 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAREIARAL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAREIARAL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|