Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 2114120..2114630 | Replicon | chromosome |
Accession | NZ_OU912926 | ||
Organism | Candidatus Nitrotoga arctica strain 6680 isolate 6680 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | MKZ32_RS09660 | Protein ID | WP_239797078.1 |
Coordinates | 2114364..2114630 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | MKZ32_RS09655 | Protein ID | WP_239797077.1 |
Coordinates | 2114120..2114380 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKZ32_RS09635 (NTG6680_2011) | 2109736..2109900 | - | 165 | WP_239797073.1 | hypothetical protein | - |
MKZ32_RS09640 (NTG6680_2012) | 2110069..2112825 | + | 2757 | WP_239797074.1 | lactate dehydrogenase | - |
MKZ32_RS09645 (NTG6680_2013) | 2112822..2113895 | + | 1074 | WP_239797075.1 | hypothetical protein | - |
MKZ32_RS09650 (NTG6680_2014) | 2113892..2114065 | + | 174 | WP_239797076.1 | hypothetical protein | - |
MKZ32_RS09655 (NTG6680_2015) | 2114120..2114380 | + | 261 | WP_239797077.1 | DUF6290 family protein | Antitoxin |
MKZ32_RS09660 (NTG6680_2016) | 2114364..2114630 | + | 267 | WP_239797078.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MKZ32_RS09665 (NTG6680_2017) | 2114639..2114827 | + | 189 | WP_239797079.1 | hypothetical protein | - |
MKZ32_RS09670 (NTG6680_2018) | 2115274..2116074 | + | 801 | WP_239797080.1 | DEAD/DEAH box helicase family protein | - |
MKZ32_RS09675 (NTG6680_2019) | 2116071..2117399 | + | 1329 | WP_239797081.1 | hypothetical protein | - |
MKZ32_RS09680 (NTG6680_2020) | 2117392..2118573 | + | 1182 | WP_239797082.1 | GIY-YIG nuclease family protein | - |
MKZ32_RS09685 (NTG6680_2021) | 2118712..2119293 | - | 582 | WP_239797083.1 | redoxin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10229.76 Da Isoelectric Point: 10.3399
>T294902 WP_239797078.1 NZ_OU912926:2114364-2114630 [Candidatus Nitrotoga arctica]
MAWTIDYAETAKAQLRKLDKQTARRIVDFMDERVAGRENPRDSGKALTGSLGGFWRYRVRDCRVICDIQDGVLRVLVVQV
GNRREIYR
MAWTIDYAETAKAQLRKLDKQTARRIVDFMDERVAGRENPRDSGKALTGSLGGFWRYRVRDCRVICDIQDGVLRVLVVQV
GNRREIYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|