Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2049816..2050579 | Replicon | chromosome |
Accession | NZ_OU912926 | ||
Organism | Candidatus Nitrotoga arctica strain 6680 isolate 6680 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | MKZ32_RS09335 | Protein ID | WP_239797022.1 |
Coordinates | 2050085..2050579 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | MKZ32_RS09330 | Protein ID | WP_239797021.1 |
Coordinates | 2049816..2050088 (+) | Length | 91 a.a. |
Genomic Context
Location: 2044943..2047663 (2721 bp)
Type: Others
Protein ID: WP_239797018.1
Type: Others
Protein ID: WP_239797018.1
Location: 2047696..2049480 (1785 bp)
Type: Others
Protein ID: WP_239797019.1
Type: Others
Protein ID: WP_239797019.1
Location: 2049521..2049871 (351 bp)
Type: Others
Protein ID: WP_239797020.1
Type: Others
Protein ID: WP_239797020.1
Location: 2049816..2050088 (273 bp)
Type: Antitoxin
Protein ID: WP_239797021.1
Type: Antitoxin
Protein ID: WP_239797021.1
Location: 2050085..2050579 (495 bp)
Type: Toxin
Protein ID: WP_239797022.1
Type: Toxin
Protein ID: WP_239797022.1
Location: 2050591..2050776 (186 bp)
Type: Others
Protein ID: WP_239797023.1
Type: Others
Protein ID: WP_239797023.1
Location: 2050793..2051725 (933 bp)
Type: Others
Protein ID: WP_239797024.1
Type: Others
Protein ID: WP_239797024.1
Location: 2051820..2052638 (819 bp)
Type: Others
Protein ID: WP_239797025.1
Type: Others
Protein ID: WP_239797025.1
Location: 2052750..2054720 (1971 bp)
Type: Others
Protein ID: WP_239797026.1
Type: Others
Protein ID: WP_239797026.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKZ32_RS09315 (NTG6680_1949) | 2044943..2047663 | + | 2721 | WP_239797018.1 | bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase | - |
MKZ32_RS09320 (NTG6680_1950) | 2047696..2049480 | + | 1785 | WP_239797019.1 | DUF262 domain-containing protein | - |
MKZ32_RS09325 (NTG6680_1951) | 2049521..2049871 | + | 351 | WP_239797020.1 | hypothetical protein | - |
MKZ32_RS09330 (NTG6680_1952) | 2049816..2050088 | + | 273 | WP_239797021.1 | DUF1778 domain-containing protein | Antitoxin |
MKZ32_RS09335 (NTG6680_1953) | 2050085..2050579 | + | 495 | WP_239797022.1 | GNAT family N-acetyltransferase | Toxin |
MKZ32_RS09340 (NTG6680_1954) | 2050591..2050776 | - | 186 | WP_239797023.1 | hypothetical protein | - |
MKZ32_RS09345 (NTG6680_1955) | 2050793..2051725 | - | 933 | WP_239797024.1 | DUF1853 family protein | - |
MKZ32_RS09350 (NTG6680_1956) | 2051820..2052638 | - | 819 | WP_239797025.1 | class I SAM-dependent methyltransferase | - |
MKZ32_RS09355 (NTG6680_1957) | 2052750..2054720 | - | 1971 | WP_239797026.1 | acetate--CoA ligase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18029.78 Da Isoelectric Point: 8.9068
>T294901 WP_239797022.1 NZ_OU912926:2050085-2050579 [Candidatus Nitrotoga arctica]
MSLQLNAPQPLATTHILDRFECGEGVLDEWLKRRAMVNQMSGASRTFVVADQDSHVYGYYAMAAGAVSHQMATSSVRRNM
PDPVPVMVLARLAVDHHAQGIKLGASLLQDAVNRAVVVSQNAGVRALLVHALHDRAKEFYEHYGFQSSPLHPMTLMLRLN
IGKA
MSLQLNAPQPLATTHILDRFECGEGVLDEWLKRRAMVNQMSGASRTFVVADQDSHVYGYYAMAAGAVSHQMATSSVRRNM
PDPVPVMVLARLAVDHHAQGIKLGASLLQDAVNRAVVVSQNAGVRALLVHALHDRAKEFYEHYGFQSSPLHPMTLMLRLN
IGKA
Download Length: 495 bp