Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 948043..948695 | Replicon | chromosome |
Accession | NZ_OU907312 | ||
Organism | Unidentified bacterial endosymbiont isolate unidentified_bacterial_endosymbiont_Chironomus_riparius |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NL324_RS04765 | Protein ID | WP_253306546.1 |
Coordinates | 948273..948695 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NL324_RS04760 | Protein ID | WP_253306545.1 |
Coordinates | 948043..948273 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL324_RS04745 | 943676..944986 | - | 1311 | WP_253306542.1 | anti-phage deoxyguanosine triphosphatase | - |
NL324_RS04750 | 944973..945569 | - | 597 | WP_253306543.1 | 5'-deoxynucleotidase | - |
NL324_RS04755 | 945622..947670 | - | 2049 | WP_253306544.1 | methionine--tRNA ligase | - |
NL324_RS04760 | 948043..948273 | + | 231 | WP_253306545.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NL324_RS04765 | 948273..948695 | + | 423 | WP_253306546.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NL324_RS04770 | 948780..948986 | - | 207 | Protein_914 | helix-turn-helix domain-containing protein | - |
NL324_RS04775 | 949051..949242 | + | 192 | Protein_915 | chorismate-binding protein | - |
NL324_RS04780 | 949343..949531 | + | 189 | WP_253306547.1 | hypothetical protein | - |
NL324_RS04785 | 949566..950084 | + | 519 | WP_253305868.1 | helix-turn-helix domain-containing protein | - |
NL324_RS04790 | 950081..950575 | + | 495 | WP_253305867.1 | IS630 family transposase | - |
NL324_RS04795 | 950585..951844 | + | 1260 | WP_253306548.1 | FAD-binding oxidoreductase | - |
NL324_RS04805 | 952541..952957 | - | 417 | WP_253306549.1 | CesT family type III secretion system chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15641.94 Da Isoelectric Point: 7.7971
>T294892 WP_253306546.1 NZ_OU907312:948273-948695 [unidentified bacterial endosymbiont]
MLQYLLDTNICIFTIKNKPREVCDTFKYHHGQICISSITLMELIYGAEKSANKKKNLDIIEGFSARLEVLTYDASAAQHS
GQLRAELARNGKSIGPYDQMIAGHARSKGLIIVTNNLREFERVPGLRSVDWTPSGDGPME
MLQYLLDTNICIFTIKNKPREVCDTFKYHHGQICISSITLMELIYGAEKSANKKKNLDIIEGFSARLEVLTYDASAAQHS
GQLRAELARNGKSIGPYDQMIAGHARSKGLIIVTNNLREFERVPGLRSVDWTPSGDGPME
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|