Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2877019..2877628 | Replicon | chromosome |
Accession | NZ_OU745390 | ||
Organism | Pseudomonas sp. Marseille-Q3773 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | LG386_RS13330 | Protein ID | WP_225778761.1 |
Coordinates | 2877019..2877321 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | LG386_RS13335 | Protein ID | WP_186688533.1 |
Coordinates | 2877314..2877628 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LG386_RS25660 | 2872874..2873002 | - | 129 | WP_009683677.1 | PA1414 family protein | - |
LG386_RS13310 | 2873127..2874020 | - | 894 | WP_225778757.1 | LysR family transcriptional regulator | - |
LG386_RS13315 | 2874126..2875295 | + | 1170 | WP_225778758.1 | MFS transporter | - |
LG386_RS13320 | 2875423..2876349 | - | 927 | WP_225778759.1 | DMT family transporter | - |
LG386_RS13325 | 2876456..2876851 | - | 396 | WP_225778760.1 | transcriptional regulator | - |
LG386_RS13330 | 2877019..2877321 | + | 303 | WP_225778761.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LG386_RS13335 | 2877314..2877628 | + | 315 | WP_186688533.1 | putative addiction module antidote protein | Antitoxin |
LG386_RS13340 | 2877680..2877952 | + | 273 | WP_225778762.1 | hypothetical protein | - |
LG386_RS13345 | 2878124..2879446 | - | 1323 | WP_225778763.1 | DEAD/DEAH box helicase | - |
LG386_RS13350 | 2879588..2880889 | + | 1302 | WP_225778764.1 | mechanosensitive ion channel family protein | - |
LG386_RS13355 | 2880934..2881230 | - | 297 | WP_225778765.1 | DUF3077 domain-containing protein | - |
LG386_RS13360 | 2881327..2881569 | - | 243 | WP_225778766.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2869162..2879446 | 10284 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11316.93 Da Isoelectric Point: 10.8773
>T294888 WP_225778761.1 NZ_OU745390:2877019-2877321 [Pseudomonas sp. Marseille-Q3773]
MKKIESSSFRHWVTGLRDANARARIISRINRLMEGLPGDVSPVGHGVSELRVHYGPGYRVYFHQAGNTFVILLCGGDKGS
QQRDIKAAHQILRSWRMQND
MKKIESSSFRHWVTGLRDANARARIISRINRLMEGLPGDVSPVGHGVSELRVHYGPGYRVYFHQAGNTFVILLCGGDKGS
QQRDIKAAHQILRSWRMQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|