Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | brnT-shpB/BrnT-BrnA |
Location | 1369639..1370212 | Replicon | chromosome |
Accession | NZ_OU745373 | ||
Organism | Cardiobacterium sp. Marseille-Q4385 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | LG374_RS06705 | Protein ID | WP_115612595.1 |
Coordinates | 1369639..1369935 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | LG374_RS06710 | Protein ID | WP_225756965.1 |
Coordinates | 1369916..1370212 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LG374_RS06675 | 1364878..1365855 | + | 978 | WP_225756960.1 | NYN domain-containing protein | - |
LG374_RS06680 | 1365860..1367053 | - | 1194 | WP_225756961.1 | beta-ketoacyl-ACP synthase | - |
LG374_RS06685 | 1367050..1367499 | - | 450 | WP_225756962.1 | hypothetical protein | - |
LG374_RS06690 | 1367520..1368215 | - | 696 | WP_225756963.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LG374_RS06695 | 1368445..1368915 | + | 471 | WP_225758006.1 | EamA family transporter | - |
LG374_RS06700 | 1368905..1369642 | + | 738 | WP_225756964.1 | competence/damage-inducible protein A | - |
LG374_RS06705 | 1369639..1369935 | + | 297 | WP_115612595.1 | BrnT family toxin | Toxin |
LG374_RS06710 | 1369916..1370212 | + | 297 | WP_225756965.1 | BrnA antitoxin family protein | Antitoxin |
LG374_RS06715 | 1370299..1371486 | + | 1188 | WP_225758007.1 | acetate kinase | - |
LG374_RS06720 | 1371498..1373573 | + | 2076 | WP_225756966.1 | phosphate acetyltransferase | - |
LG374_RS06725 | 1373650..1373886 | + | 237 | WP_225756967.1 | twin-arginine translocase TatA/TatE family subunit | - |
LG374_RS06730 | 1373896..1374342 | + | 447 | WP_225756968.1 | Sec-independent protein translocase protein TatB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11646.28 Da Isoelectric Point: 7.4192
>T294885 WP_115612595.1 NZ_OU745373:1369639-1369935 [Cardiobacterium sp. Marseille-Q4385]
MNYRFEWDDGKERINIRKHSIDFTMASTVFLDPLHQMVQDRIEGGEWRWQTIGIVKGQVVVLVAHTVVETDTMTCIRIIS
ARHATKKEQEYYYGRTYH
MNYRFEWDDGKERINIRKHSIDFTMASTVFLDPLHQMVQDRIEGGEWRWQTIGIVKGQVVVLVAHTVVETDTMTCIRIIS
ARHATKKEQEYYYGRTYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|