294882

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-virA/YafQ(toxin)
Location 36158..36737 Replicon plasmid 2
Accession NZ_OU701460
Organism Campylobacter upsaliensis strain Campylobacter upsaliensis 17-M197059

Toxin (Protein)


Gene name relE Uniprot ID A0A381F3C2
Locus tag LDP95_RS08625 Protein ID WP_039883072.1
Coordinates 36158..36433 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name virA Uniprot ID A0A381F390
Locus tag LDP95_RS08630 Protein ID WP_004276264.1
Coordinates 36426..36737 (-) Length 104 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDP95_RS08570 (CU197059_001708) 31200..31448 + 249 WP_224198580.1 hypothetical protein -
LDP95_RS08575 (CU197059_001709) 31531..31674 + 144 WP_224198581.1 hypothetical protein -
LDP95_RS08580 (CU197059_001710) 31915..32424 + 510 WP_213275855.1 hypothetical protein -
LDP95_RS08585 (CU197059_001711) 32427..33017 + 591 WP_224198582.1 thermonuclease family protein -
LDP95_RS08590 (CU197059_001712) 33111..33425 + 315 WP_213275859.1 DNA methyltransferase -
LDP95_RS08595 (CU197059_001713) 33435..33734 + 300 WP_115631320.1 hypothetical protein -
LDP95_RS08600 (CU197059_001714) 33793..34080 - 288 WP_213243051.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
LDP95_RS08605 (CU197059_001715) 34070..34300 - 231 WP_115631316.1 CopG family transcriptional regulator -
LDP95_RS08610 (CU197059_001716) 34634..35479 + 846 WP_224198583.1 BRO family protein -
LDP95_RS08615 (CU197059_001717) 35479..35910 + 432 WP_004276262.1 lytic transglycosylase domain-containing protein -
LDP95_RS08620 (CU197059_001718) 35913..36161 + 249 WP_004276263.1 hypothetical protein -
LDP95_RS08625 (CU197059_001719) 36158..36433 - 276 WP_039883072.1 type II toxin-antitoxin system YafQ family toxin Toxin
LDP95_RS08630 (CU197059_001720) 36426..36737 - 312 WP_004276264.1 hypothetical protein Antitoxin
LDP95_RS08635 (CU197059_001721) 36860..37492 - 633 WP_213243054.1 hypothetical protein -
LDP95_RS08640 (CU197059_001722) 37676..37957 + 282 WP_004276266.1 hypothetical protein -
LDP95_RS08645 (CU197059_001723) 37957..38262 + 306 WP_004276267.1 type IV conjugative transfer system protein TraL -
LDP95_RS08650 (CU197059_001724) 38263..38856 + 594 WP_004276268.1 TraE/TraK family type IV conjugative transfer system protein -
LDP95_RS08655 (CU197059_001725) 38853..39635 + 783 WP_004276269.1 type-F conjugative transfer system secretin TraK -
LDP95_RS08660 (CU197059_001726) 39632..40948 + 1317 WP_213243056.1 TraB/VirB10 family protein -
LDP95_RS08665 (CU197059_001727) 40952..41716 + 765 WP_213243057.1 DsbC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..71909 71909


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(4-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11155.09 Da        Isoelectric Point: 10.1256

>T294882 WP_039883072.1 NZ_OU701460:c36433-36158 [Campylobacter upsaliensis]
MRKQVFQNAFKRDLKLVRKQSWDIKAIQKCVEDLAILDILPKKYEDHPLKGDLKEFRECHIFGDLVIIYKRNNKEINYYR
IGRHQDLFKKY

Download         Length: 276 bp

Antitoxin


Download         Length: 104 a.a.        Molecular weight: 12351.10 Da        Isoelectric Point: 9.8614

>AT294882 WP_004276264.1 NZ_OU701460:c36737-36426 [Campylobacter upsaliensis]
MYNYAKYENATRKDIIKALNLAEKKEKKLQEQLKENKEFFKFLQKKFNESFNPLRQVKTKKQKKYDEPTEETKLILAKNE
PTKYNNFNDLLNAIDDELKADNA

Download         Length: 312 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A381F3C2

Antitoxin

Source ID Structure
AlphaFold DB A0A381F390

References