Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-virA/YafQ(toxin) |
| Location | 36158..36737 | Replicon | plasmid 2 |
| Accession | NZ_OU701460 | ||
| Organism | Campylobacter upsaliensis strain Campylobacter upsaliensis 17-M197059 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A381F3C2 |
| Locus tag | LDP95_RS08625 | Protein ID | WP_039883072.1 |
| Coordinates | 36158..36433 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | virA | Uniprot ID | A0A381F390 |
| Locus tag | LDP95_RS08630 | Protein ID | WP_004276264.1 |
| Coordinates | 36426..36737 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDP95_RS08570 (CU197059_001708) | 31200..31448 | + | 249 | WP_224198580.1 | hypothetical protein | - |
| LDP95_RS08575 (CU197059_001709) | 31531..31674 | + | 144 | WP_224198581.1 | hypothetical protein | - |
| LDP95_RS08580 (CU197059_001710) | 31915..32424 | + | 510 | WP_213275855.1 | hypothetical protein | - |
| LDP95_RS08585 (CU197059_001711) | 32427..33017 | + | 591 | WP_224198582.1 | thermonuclease family protein | - |
| LDP95_RS08590 (CU197059_001712) | 33111..33425 | + | 315 | WP_213275859.1 | DNA methyltransferase | - |
| LDP95_RS08595 (CU197059_001713) | 33435..33734 | + | 300 | WP_115631320.1 | hypothetical protein | - |
| LDP95_RS08600 (CU197059_001714) | 33793..34080 | - | 288 | WP_213243051.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| LDP95_RS08605 (CU197059_001715) | 34070..34300 | - | 231 | WP_115631316.1 | CopG family transcriptional regulator | - |
| LDP95_RS08610 (CU197059_001716) | 34634..35479 | + | 846 | WP_224198583.1 | BRO family protein | - |
| LDP95_RS08615 (CU197059_001717) | 35479..35910 | + | 432 | WP_004276262.1 | lytic transglycosylase domain-containing protein | - |
| LDP95_RS08620 (CU197059_001718) | 35913..36161 | + | 249 | WP_004276263.1 | hypothetical protein | - |
| LDP95_RS08625 (CU197059_001719) | 36158..36433 | - | 276 | WP_039883072.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| LDP95_RS08630 (CU197059_001720) | 36426..36737 | - | 312 | WP_004276264.1 | hypothetical protein | Antitoxin |
| LDP95_RS08635 (CU197059_001721) | 36860..37492 | - | 633 | WP_213243054.1 | hypothetical protein | - |
| LDP95_RS08640 (CU197059_001722) | 37676..37957 | + | 282 | WP_004276266.1 | hypothetical protein | - |
| LDP95_RS08645 (CU197059_001723) | 37957..38262 | + | 306 | WP_004276267.1 | type IV conjugative transfer system protein TraL | - |
| LDP95_RS08650 (CU197059_001724) | 38263..38856 | + | 594 | WP_004276268.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| LDP95_RS08655 (CU197059_001725) | 38853..39635 | + | 783 | WP_004276269.1 | type-F conjugative transfer system secretin TraK | - |
| LDP95_RS08660 (CU197059_001726) | 39632..40948 | + | 1317 | WP_213243056.1 | TraB/VirB10 family protein | - |
| LDP95_RS08665 (CU197059_001727) | 40952..41716 | + | 765 | WP_213243057.1 | DsbC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..71909 | 71909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 11155.09 Da Isoelectric Point: 10.1256
>T294882 WP_039883072.1 NZ_OU701460:c36433-36158 [Campylobacter upsaliensis]
MRKQVFQNAFKRDLKLVRKQSWDIKAIQKCVEDLAILDILPKKYEDHPLKGDLKEFRECHIFGDLVIIYKRNNKEINYYR
IGRHQDLFKKY
MRKQVFQNAFKRDLKLVRKQSWDIKAIQKCVEDLAILDILPKKYEDHPLKGDLKEFRECHIFGDLVIIYKRNNKEINYYR
IGRHQDLFKKY
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A381F3C2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A381F390 |