Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4901685..4902207 | Replicon | chromosome |
| Accession | NZ_OU701452 | ||
| Organism | Escherichia coli isolate CNR65D6 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A829L6G8 |
| Locus tag | LWS60_RS23565 | Protein ID | WP_001105433.1 |
| Coordinates | 4901917..4902207 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0SC69 |
| Locus tag | LWS60_RS23560 | Protein ID | WP_000212715.1 |
| Coordinates | 4901685..4901927 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS60_RS23540 (4897404) | 4897404..4898777 | + | 1374 | WP_001522402.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
| LWS60_RS23545 (4898927) | 4898927..4899478 | - | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
| LWS60_RS23550 (4899572) | 4899572..4900924 | + | 1353 | WP_001162173.1 | metalloprotease PmbA | - |
| LWS60_RS23555 (4901107) | 4901107..4901493 | + | 387 | WP_001232246.1 | cytochrome b562 | - |
| LWS60_RS23560 (4901685) | 4901685..4901927 | + | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LWS60_RS23565 (4901917) | 4901917..4902207 | + | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LWS60_RS23570 (4902208) | 4902208..4902672 | - | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LWS60_RS23575 (4902852) | 4902852..4904990 | - | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LWS60_RS23580 (4905384) | 4905384..4907039 | - | 1656 | WP_001550509.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T294881 WP_001105433.1 NZ_OU701452:4901917-4902207 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829L6G8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H4B3 |