Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3461348..3462183 Replicon chromosome
Accession NZ_OU701452
Organism Escherichia coli isolate CNR65D6

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag LWS60_RS16740 Protein ID WP_001564063.1
Coordinates 3461806..3462183 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0K5N986
Locus tag LWS60_RS16735 Protein ID WP_021553056.1
Coordinates 3461348..3461716 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LWS60_RS16700 (3457007) 3457007..3457687 + 681 WP_001278649.1 WYL domain-containing protein -
LWS60_RS16705 (3457838) 3457838..3458515 + 678 WP_001564058.1 hypothetical protein -
LWS60_RS16710 (3458521) 3458521..3458754 + 234 WP_001278293.1 DUF905 family protein -
LWS60_RS16715 (3458844) 3458844..3459662 + 819 WP_001564059.1 DUF932 domain-containing protein -
LWS60_RS16720 (3459928) 3459928..3460407 + 480 WP_001564060.1 antirestriction protein -
LWS60_RS16725 (3460423) 3460423..3460899 + 477 WP_021553055.1 RadC family protein -
LWS60_RS16730 (3460964) 3460964..3461185 + 222 WP_000692345.1 DUF987 domain-containing protein -
LWS60_RS16735 (3461348) 3461348..3461716 + 369 WP_021553056.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LWS60_RS16740 (3461806) 3461806..3462183 + 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
LWS60_RS16745 (3462180) 3462180..3462329 + 150 Protein_3284 DUF5983 family protein -
LWS60_RS16750 (3462408) 3462408..3462602 + 195 WP_024181941.1 DUF957 domain-containing protein -
LWS60_RS16755 (3462687) 3462687..3463529 + 843 Protein_3286 DUF4942 domain-containing protein -
LWS60_RS16760 (3463872) 3463872..3464042 + 171 Protein_3287 IS110 family transposase -
LWS60_RS16765 (3464852) 3464852..3465835 + 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
LWS60_RS16770 (3465907) 3465907..3467055 + 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 3390042..3463656 73614


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T294874 WP_001564063.1 NZ_OU701452:3461806-3462183 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13615.39 Da        Isoelectric Point: 7.0264

>AT294874 WP_021553056.1 NZ_OU701452:3461348-3461716 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0K5N986

References