Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3313320..3313974 | Replicon | chromosome |
Accession | NZ_OU701452 | ||
Organism | Escherichia coli isolate CNR65D6 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | LWS60_RS15960 | Protein ID | WP_000244781.1 |
Coordinates | 3313320..3313727 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0V9GG32 |
Locus tag | LWS60_RS15965 | Protein ID | WP_001564007.1 |
Coordinates | 3313708..3313974 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LWS60_RS15940 (3309277) | 3309277..3311010 | - | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
LWS60_RS15945 (3311016) | 3311016..3311726 | - | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LWS60_RS15950 (3311751) | 3311751..3312647 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
LWS60_RS15955 (3312759) | 3312759..3313280 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
LWS60_RS15960 (3313320) | 3313320..3313727 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
LWS60_RS15965 (3313708) | 3313708..3313974 | - | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
LWS60_RS15970 (3314217) | 3314217..3315197 | + | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
LWS60_RS15975 (3315274) | 3315274..3315933 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
LWS60_RS15980 (3316097) | 3316097..3316408 | - | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
LWS60_RS15985 (3316453) | 3316453..3317886 | + | 1434 | WP_001564009.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T294873 WP_000244781.1 NZ_OU701452:c3313727-3313320 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9GG32 |