Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1593471..1594109 | Replicon | chromosome |
Accession | NZ_OU701452 | ||
Organism | Escherichia coli isolate CNR65D6 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
Locus tag | LWS60_RS07575 | Protein ID | WP_000813795.1 |
Coordinates | 1593471..1593647 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LWS60_RS07580 | Protein ID | WP_076797675.1 |
Coordinates | 1593693..1594109 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LWS60_RS07555 (1589093) | 1589093..1590304 | - | 1212 | WP_071591517.1 | BenE family transporter YdcO | - |
LWS60_RS07560 (1590357) | 1590357..1590893 | + | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
LWS60_RS07565 (1590966) | 1590966..1592927 | + | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
LWS60_RS07570 (1593019) | 1593019..1593249 | - | 231 | WP_023910283.1 | YncJ family protein | - |
LWS60_RS07575 (1593471) | 1593471..1593647 | + | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
LWS60_RS07580 (1593693) | 1593693..1594109 | + | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
LWS60_RS07585 (1594188) | 1594188..1595594 | + | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
LWS60_RS07590 (1595839) | 1595839..1596984 | + | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
LWS60_RS07595 (1597002) | 1597002..1598015 | + | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
LWS60_RS07600 (1598016) | 1598016..1598957 | + | 942 | WP_106106616.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T294864 WP_000813795.1 NZ_OU701452:1593471-1593647 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT294864 WP_076797675.1 NZ_OU701452:1593693-1594109 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|