Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 957156..957861 | Replicon | chromosome |
| Accession | NZ_OU701452 | ||
| Organism | Escherichia coli isolate CNR65D6 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | LWS60_RS04460 | Protein ID | WP_000539521.1 |
| Coordinates | 957475..957861 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LWS60_RS04455 | Protein ID | WP_001280945.1 |
| Coordinates | 957156..957485 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS60_RS04440 (952313) | 952313..953224 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
| LWS60_RS04445 (953402) | 953402..955750 | + | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
| LWS60_RS04450 (955758) | 955758..957086 | + | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
| LWS60_RS04455 (957156) | 957156..957485 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| LWS60_RS04460 (957475) | 957475..957861 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LWS60_RS04465 (958087) | 958087..959412 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| LWS60_RS04470 (959625) | 959625..960008 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| LWS60_RS04475 (960119) | 960119..961234 | + | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
| LWS60_RS04480 (961231) | 961231..961857 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T294856 WP_000539521.1 NZ_OU701452:c957861-957475 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|