Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 504195..504813 | Replicon | chromosome |
| Accession | NZ_OU701452 | ||
| Organism | Escherichia coli isolate CNR65D6 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | LWS60_RS02330 | Protein ID | WP_001291435.1 |
| Coordinates | 504195..504413 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | LWS60_RS02335 | Protein ID | WP_000344800.1 |
| Coordinates | 504439..504813 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS60_RS02295 (499484) | 499484..500056 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| LWS60_RS02300 (500087) | 500087..500398 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| LWS60_RS02310 (500777) | 500777..501130 | + | 354 | WP_001550741.1 | DUF1428 family protein | - |
| LWS60_RS02315 (501172) | 501172..502722 | - | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| LWS60_RS02320 (502886) | 502886..503356 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| LWS60_RS02325 (503472) | 503472..504023 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| LWS60_RS02330 (504195) | 504195..504413 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| LWS60_RS02335 (504439) | 504439..504813 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| LWS60_RS02340 (505359) | 505359..508508 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| LWS60_RS02345 (508531) | 508531..509724 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T294855 WP_001291435.1 NZ_OU701452:c504413-504195 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT294855 WP_000344800.1 NZ_OU701452:c504813-504439 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |