Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4572525..4573120 | Replicon | chromosome |
Accession | NZ_OU701449 | ||
Organism | Escherichia coli isolate CNR85I8 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
Locus tag | LWS57_RS22160 | Protein ID | WP_019842229.1 |
Coordinates | 4572525..4572875 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | LWS57_RS22165 | Protein ID | WP_001223213.1 |
Coordinates | 4572869..4573120 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LWS57_RS22140 (4567855) | 4567855..4568877 | - | 1023 | WP_001550507.1 | ABC transporter permease | - |
LWS57_RS22145 (4568891) | 4568891..4570393 | - | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
LWS57_RS22150 (4570525) | 4570525..4571481 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
LWS57_RS22155 (4571791) | 4571791..4572321 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
LWS57_RS22160 (4572525) | 4572525..4572875 | - | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
LWS57_RS22165 (4572869) | 4572869..4573120 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
LWS57_RS22170 (4573332) | 4573332..4573673 | - | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
LWS57_RS22175 (4573676) | 4573676..4577455 | - | 3780 | WP_001550503.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T294850 WP_019842229.1 NZ_OU701449:c4572875-4572525 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NWK6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4JJX7 |