Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3782518..3783136 | Replicon | chromosome |
Accession | NZ_OU701449 | ||
Organism | Escherichia coli isolate CNR85I8 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LWS57_RS18270 | Protein ID | WP_001291435.1 |
Coordinates | 3782918..3783136 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LWS57_RS18265 | Protein ID | WP_000344800.1 |
Coordinates | 3782518..3782892 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LWS57_RS18255 (3777607) | 3777607..3778800 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LWS57_RS18260 (3778823) | 3778823..3781972 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
LWS57_RS18265 (3782518) | 3782518..3782892 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LWS57_RS18270 (3782918) | 3782918..3783136 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LWS57_RS18275 (3783308) | 3783308..3783859 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
LWS57_RS18280 (3783975) | 3783975..3784445 | + | 471 | WP_000136192.1 | YlaC family protein | - |
LWS57_RS18285 (3784609) | 3784609..3786159 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LWS57_RS18290 (3786201) | 3786201..3786554 | - | 354 | WP_001550741.1 | DUF1428 family protein | - |
LWS57_RS18300 (3786933) | 3786933..3787244 | + | 312 | WP_000409911.1 | MGMT family protein | - |
LWS57_RS18305 (3787275) | 3787275..3787847 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T294846 WP_001291435.1 NZ_OU701449:3782918-3783136 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT294846 WP_000344800.1 NZ_OU701449:3782518-3782892 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |