Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3379977..3380682 | Replicon | chromosome |
| Accession | NZ_OU701449 | ||
| Organism | Escherichia coli isolate CNR85I8 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | LWS57_RS16495 | Protein ID | WP_000539521.1 |
| Coordinates | 3379977..3380363 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LWS57_RS16500 | Protein ID | WP_001280945.1 |
| Coordinates | 3380353..3380682 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS57_RS16475 (3375981) | 3375981..3376607 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| LWS57_RS16480 (3376604) | 3376604..3377719 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
| LWS57_RS16485 (3377830) | 3377830..3378213 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| LWS57_RS16490 (3378426) | 3378426..3379751 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| LWS57_RS16495 (3379977) | 3379977..3380363 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LWS57_RS16500 (3380353) | 3380353..3380682 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| LWS57_RS16505 (3380752) | 3380752..3382080 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
| LWS57_RS16510 (3382088) | 3382088..3384436 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
| LWS57_RS16515 (3384614) | 3384614..3385525 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T294845 WP_000539521.1 NZ_OU701449:3379977-3380363 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|