Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 977837..978491 | Replicon | chromosome |
Accession | NZ_OU701449 | ||
Organism | Escherichia coli isolate CNR85I8 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | LWS57_RS04740 | Protein ID | WP_000244781.1 |
Coordinates | 978084..978491 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0V9GG32 |
Locus tag | LWS57_RS04735 | Protein ID | WP_001564007.1 |
Coordinates | 977837..978103 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LWS57_RS04715 (973925) | 973925..975358 | - | 1434 | WP_001564009.1 | 6-phospho-beta-glucosidase BglA | - |
LWS57_RS04720 (975403) | 975403..975714 | + | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
LWS57_RS04725 (975878) | 975878..976537 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
LWS57_RS04730 (976614) | 976614..977594 | - | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
LWS57_RS04735 (977837) | 977837..978103 | + | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
LWS57_RS04740 (978084) | 978084..978491 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
LWS57_RS04745 (978531) | 978531..979052 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
LWS57_RS04750 (979164) | 979164..980060 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
LWS57_RS04755 (980085) | 980085..980795 | + | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LWS57_RS04760 (980801) | 980801..982534 | + | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T294835 WP_000244781.1 NZ_OU701449:978084-978491 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9GG32 |