Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 829661..830496 Replicon chromosome
Accession NZ_OU701449
Organism Escherichia coli isolate CNR85I8

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag LWS57_RS03960 Protein ID WP_001564063.1
Coordinates 829661..830038 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0K5N986
Locus tag LWS57_RS03965 Protein ID WP_021553056.1
Coordinates 830128..830496 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LWS57_RS03930 (824789) 824789..825937 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
LWS57_RS03935 (826009) 826009..826992 - 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
LWS57_RS03940 (827802) 827802..827972 - 171 Protein_773 IS110 family transposase -
LWS57_RS03945 (828315) 828315..829157 - 843 Protein_774 DUF4942 domain-containing protein -
LWS57_RS03950 (829242) 829242..829436 - 195 WP_024181941.1 DUF957 domain-containing protein -
LWS57_RS03955 (829515) 829515..829664 - 150 Protein_776 DUF5983 family protein -
LWS57_RS03960 (829661) 829661..830038 - 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
LWS57_RS03965 (830128) 830128..830496 - 369 WP_021553056.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LWS57_RS03970 (830659) 830659..830880 - 222 WP_000692345.1 DUF987 domain-containing protein -
LWS57_RS03975 (830945) 830945..831421 - 477 WP_021553055.1 RadC family protein -
LWS57_RS03980 (831437) 831437..831916 - 480 WP_001564060.1 antirestriction protein -
LWS57_RS03985 (832182) 832182..833000 - 819 WP_001564059.1 DUF932 domain-containing protein -
LWS57_RS03990 (833090) 833090..833323 - 234 WP_001278293.1 DUF905 family protein -
LWS57_RS03995 (833329) 833329..834006 - 678 WP_001564058.1 hypothetical protein -
LWS57_RS04000 (834157) 834157..834837 - 681 WP_001278649.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 828188..901769 73581


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T294834 WP_001564063.1 NZ_OU701449:c830038-829661 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13615.39 Da        Isoelectric Point: 7.0264

>AT294834 WP_021553056.1 NZ_OU701449:c830496-830128 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0K5N986

References