Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 829661..830496 | Replicon | chromosome |
| Accession | NZ_OU701449 | ||
| Organism | Escherichia coli isolate CNR85I8 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0A1A9A5 |
| Locus tag | LWS57_RS03960 | Protein ID | WP_001564063.1 |
| Coordinates | 829661..830038 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0K5N986 |
| Locus tag | LWS57_RS03965 | Protein ID | WP_021553056.1 |
| Coordinates | 830128..830496 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS57_RS03930 (824789) | 824789..825937 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| LWS57_RS03935 (826009) | 826009..826992 | - | 984 | WP_001296394.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| LWS57_RS03940 (827802) | 827802..827972 | - | 171 | Protein_773 | IS110 family transposase | - |
| LWS57_RS03945 (828315) | 828315..829157 | - | 843 | Protein_774 | DUF4942 domain-containing protein | - |
| LWS57_RS03950 (829242) | 829242..829436 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| LWS57_RS03955 (829515) | 829515..829664 | - | 150 | Protein_776 | DUF5983 family protein | - |
| LWS57_RS03960 (829661) | 829661..830038 | - | 378 | WP_001564063.1 | TA system toxin CbtA family protein | Toxin |
| LWS57_RS03965 (830128) | 830128..830496 | - | 369 | WP_021553056.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LWS57_RS03970 (830659) | 830659..830880 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LWS57_RS03975 (830945) | 830945..831421 | - | 477 | WP_021553055.1 | RadC family protein | - |
| LWS57_RS03980 (831437) | 831437..831916 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| LWS57_RS03985 (832182) | 832182..833000 | - | 819 | WP_001564059.1 | DUF932 domain-containing protein | - |
| LWS57_RS03990 (833090) | 833090..833323 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| LWS57_RS03995 (833329) | 833329..834006 | - | 678 | WP_001564058.1 | hypothetical protein | - |
| LWS57_RS04000 (834157) | 834157..834837 | - | 681 | WP_001278649.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papX | 828188..901769 | 73581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14094.09 Da Isoelectric Point: 7.8045
>T294834 WP_001564063.1 NZ_OU701449:c830038-829661 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13615.39 Da Isoelectric Point: 7.0264
>AT294834 WP_021553056.1 NZ_OU701449:c830496-830128 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A9A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K5N986 |