Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3849778..3850364 | Replicon | chromosome |
| Accession | NZ_OU659204 | ||
| Organism | Providencia alcalifaciens strain 2019-04-29291-1-1 isolate 2019-04-29291-1-1 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | LDO73_RS17600 | Protein ID | WP_224059585.1 |
| Coordinates | 3850062..3850364 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LDO73_RS17595 | Protein ID | WP_224059584.1 |
| Coordinates | 3849778..3850065 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO73_RS17570 (NVI2019_GHJFPKLH_03522) | 3844838..3845815 | - | 978 | WP_224059580.1 | 6-phosphofructokinase | - |
| LDO73_RS17575 (NVI2019_GHJFPKLH_03523) | 3846214..3847158 | - | 945 | WP_154603265.1 | phosphatidate cytidylyltransferase | - |
| LDO73_RS17580 (NVI2019_GHJFPKLH_03524) | 3847155..3847796 | - | 642 | WP_224059581.1 | lysophospholipid acyltransferase family protein | - |
| LDO73_RS17585 (NVI2019_GHJFPKLH_03525) | 3848034..3848789 | - | 756 | WP_224059582.1 | M48 family metallopeptidase | - |
| LDO73_RS17590 (NVI2019_GHJFPKLH_03526) | 3849043..3849624 | - | 582 | WP_224059583.1 | HutD family protein | - |
| LDO73_RS17595 (NVI2019_GHJFPKLH_03527) | 3849778..3850065 | - | 288 | WP_224059584.1 | putative addiction module antidote protein | Antitoxin |
| LDO73_RS17600 (NVI2019_GHJFPKLH_03528) | 3850062..3850364 | - | 303 | WP_224059585.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LDO73_RS17605 (NVI2019_GHJFPKLH_03529) | 3850611..3851171 | - | 561 | WP_224059586.1 | Spy/CpxP family protein refolding chaperone | - |
| LDO73_RS17610 (NVI2019_GHJFPKLH_03530) | 3851323..3852021 | + | 699 | WP_006660535.1 | envelope stress response regulator transcription factor CpxR | - |
| LDO73_RS17615 (NVI2019_GHJFPKLH_03531) | 3852018..3853388 | + | 1371 | WP_036950809.1 | envelope stress sensor histidine kinase CpxA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11587.41 Da Isoelectric Point: 10.1293
>T294829 WP_224059585.1 NZ_OU659204:c3850364-3850062 [Providencia alcalifaciens]
MLTVLTTDIFNRWMHDLKDIRAKTKIQVRIRRLKQGNFGDVEPIGDGFSELKIHEGKGYRVYLRKIDNTIVLLISGGDKS
TQQKDIDKAKQIFREIEGDL
MLTVLTTDIFNRWMHDLKDIRAKTKIQVRIRRLKQGNFGDVEPIGDGFSELKIHEGKGYRVYLRKIDNTIVLLISGGDKS
TQQKDIDKAKQIFREIEGDL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|