Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2707753..2708410 | Replicon | chromosome |
| Accession | NZ_OU659204 | ||
| Organism | Providencia alcalifaciens strain 2019-04-29291-1-1 isolate 2019-04-29291-1-1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | LDO73_RS12435 | Protein ID | WP_224058187.1 |
| Coordinates | 2707753..2708163 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | LDO73_RS12440 | Protein ID | WP_036951240.1 |
| Coordinates | 2708144..2708410 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO73_RS12415 (NVI2019_GHJFPKLH_02495) | 2703727..2705460 | - | 1734 | WP_224058180.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LDO73_RS12420 (NVI2019_GHJFPKLH_02496) | 2705469..2706170 | - | 702 | WP_224058181.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LDO73_RS12425 (NVI2019_GHJFPKLH_02497) | 2706189..2707091 | - | 903 | WP_224058183.1 | site-specific tyrosine recombinase XerD | - |
| LDO73_RS12430 (NVI2019_GHJFPKLH_02498) | 2707209..2707727 | + | 519 | WP_224058185.1 | flavodoxin FldB | - |
| LDO73_RS12435 (NVI2019_GHJFPKLH_02499) | 2707753..2708163 | - | 411 | WP_224058187.1 | protein YgfX | Toxin |
| LDO73_RS12440 (NVI2019_GHJFPKLH_02500) | 2708144..2708410 | - | 267 | WP_036951240.1 | FAD assembly factor SdhE | Antitoxin |
| LDO73_RS12445 (NVI2019_GHJFPKLH_02501) | 2708702..2709688 | + | 987 | WP_224058189.1 | tRNA-modifying protein YgfZ | - |
| LDO73_RS12450 (NVI2019_GHJFPKLH_02502) | 2709700..2710320 | + | 621 | WP_224058191.1 | HD domain-containing protein | - |
| LDO73_RS12455 (NVI2019_GHJFPKLH_02503) | 2710411..2711148 | + | 738 | WP_224058193.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15471.43 Da Isoelectric Point: 10.6257
>T294827 WP_224058187.1 NZ_OU659204:c2708163-2707753 [Providencia alcalifaciens]
VVLWKSNLSISWKTQLFSTCLHGVTGIILLVAPWAPGNSMIWLPLLVVLVASWAKSQKNISKVKGVAVLVNGNKLQWKKN
EWEIIKAPWCSRFGILLTLNALQGKPQKLRLWIAKDSVCEENWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCLHGVTGIILLVAPWAPGNSMIWLPLLVVLVASWAKSQKNISKVKGVAVLVNGNKLQWKKN
EWEIIKAPWCSRFGILLTLNALQGKPQKLRLWIAKDSVCEENWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|