Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 2606912..2607543 | Replicon | chromosome |
| Accession | NZ_OU659204 | ||
| Organism | Providencia alcalifaciens strain 2019-04-29291-1-1 isolate 2019-04-29291-1-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LDO73_RS11980 | Protein ID | WP_224058070.1 |
| Coordinates | 2607175..2607543 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | LDO73_RS11975 | Protein ID | WP_224058069.1 |
| Coordinates | 2606912..2607175 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO73_RS11960 (NVI2019_GHJFPKLH_02404) | 2602343..2603374 | + | 1032 | WP_224058067.1 | ABC transporter substrate-binding protein | - |
| LDO73_RS11965 (NVI2019_GHJFPKLH_02405) | 2603623..2605701 | + | 2079 | WP_211886162.1 | iron ABC transporter permease | - |
| LDO73_RS11970 (NVI2019_GHJFPKLH_02406) | 2605718..2606758 | + | 1041 | WP_224058068.1 | ferric ABC transporter ATP-binding protein | - |
| LDO73_RS11975 (NVI2019_GHJFPKLH_02407) | 2606912..2607175 | + | 264 | WP_224058069.1 | antitoxin | Antitoxin |
| LDO73_RS11980 (NVI2019_GHJFPKLH_02408) | 2607175..2607543 | + | 369 | WP_224058070.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LDO73_RS11985 (NVI2019_GHJFPKLH_02409) | 2607643..2611530 | - | 3888 | WP_224058071.1 | phosphoribosylformylglycinamidine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13308.16 Da Isoelectric Point: 6.6990
>T294826 WP_224058070.1 NZ_OU659204:2607175-2607543 [Providencia alcalifaciens]
MVKAKRPHKGQIWHINGDPVAGKEFKGPHYYLVVTDAQINTALGTSICVPITSGGSRARTQNVTVYLDGSSTDTGNITGC
ILCYQLRSLDLIARKATYSATLNEDIFEEVLSNIIDIIDPQI
MVKAKRPHKGQIWHINGDPVAGKEFKGPHYYLVVTDAQINTALGTSICVPITSGGSRARTQNVTVYLDGSSTDTGNITGC
ILCYQLRSLDLIARKATYSATLNEDIFEEVLSNIIDIIDPQI
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|