Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-higA/HTH_XRE(antitoxin) |
Location | 44970..45391 | Replicon | plasmid 3 |
Accession | NZ_OU659164 | ||
Organism | Providencia alcalifaciens strain 2019-04-29292-1-3 isolate 2019-04-29292-1-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LDO74_RS20315 | Protein ID | WP_036974639.1 |
Coordinates | 44970..45248 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LDO74_RS21285 | Protein ID | WP_282563865.1 |
Coordinates | 45248..45391 (+) | Length | 48 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LDO74_RS20285 (NVI2019_OGMBKCAO_04080) | 40508..41143 | + | 636 | WP_282563867.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
LDO74_RS21280 | 41809..42798 | + | 990 | Protein_39 | conjugal transfer protein TraN | - |
LDO74_RS20295 (NVI2019_OGMBKCAO_04082) | 42984..43739 | + | 756 | WP_282490794.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
LDO74_RS20300 (NVI2019_OGMBKCAO_04083) | 43760..44050 | + | 291 | WP_224051145.1 | hypothetical protein | - |
LDO74_RS20305 (NVI2019_OGMBKCAO_04084) | 44056..44586 | + | 531 | WP_224051144.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
LDO74_RS20310 (NVI2019_OGMBKCAO_04085) | 44689..44979 | + | 291 | WP_282563866.1 | ribbon-helix-helix domain-containing protein | - |
LDO74_RS20315 (NVI2019_OGMBKCAO_04086) | 44970..45248 | + | 279 | WP_036974639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LDO74_RS21285 (NVI2019_OGMBKCAO_04087) | 45248..45391 | + | 144 | WP_282563865.1 | hypothetical protein | Antitoxin |
LDO74_RS20325 (NVI2019_OGMBKCAO_04088) | 45797..47191 | + | 1395 | WP_282563883.1 | conjugal transfer pilus assembly protein TraH | - |
LDO74_RS20330 (NVI2019_OGMBKCAO_04089) | 47204..50098 | + | 2895 | WP_282563864.1 | conjugal transfer mating-pair stabilization protein TraG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..91748 | 91748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10909.82 Da Isoelectric Point: 9.8960
>T294818 WP_036974639.1 NZ_OU659164:44970-45248 [Providencia alcalifaciens]
MELKWTSKALSDLSRVYDFLALSNSVAAARVVQTLTKAPMLLLIKNPRMGEQLFQFMPHEVRRIVVVNYEIRYELIDSTI
YILRIWHTREDR
MELKWTSKALSDLSRVYDFLALSNSVAAARVVQTLTKAPMLLLIKNPRMGEQLFQFMPHEVRRIVVVNYEIRYELIDSTI
YILRIWHTREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|