294815

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 76911..77433 Replicon plasmid 2
Accession NZ_OU659163
Organism Providencia alcalifaciens strain 2019-04-29292-1-3 isolate 2019-04-29292-1-3

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LDO74_RS19675 Protein ID WP_036979529.1
Coordinates 76911..77192 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag LDO74_RS19680 Protein ID WP_036974972.1
Coordinates 77182..77433 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDO74_RS19635 (NVI2019_OGMBKCAO_03947) 72916..73125 - 210 WP_036979533.1 hypothetical protein -
LDO74_RS19640 (NVI2019_OGMBKCAO_03948) 73220..73492 - 273 WP_036979555.1 helix-turn-helix transcriptional regulator -
LDO74_RS19645 (NVI2019_OGMBKCAO_03949) 73479..73805 - 327 WP_036979532.1 type II toxin-antitoxin system RelE/ParE family toxin -
LDO74_RS19650 (NVI2019_OGMBKCAO_03950) 74012..75280 - 1269 WP_036979530.1 translesion error-prone DNA polymerase V subunit UmuC -
LDO74_RS19655 (NVI2019_OGMBKCAO_03951) 75393..75671 - 279 WP_230087585.1 S24 family peptidase -
LDO74_RS19660 (NVI2019_OGMBKCAO_03952) 75866..76135 - 270 WP_036979554.1 plasmid partitioning/stability family protein -
LDO74_RS19670 76380..76682 - 303 Protein_68 recombinase family protein -
LDO74_RS19675 (NVI2019_OGMBKCAO_03954) 76911..77192 - 282 WP_036979529.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LDO74_RS19680 (NVI2019_OGMBKCAO_03955) 77182..77433 - 252 WP_036974972.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LDO74_RS19685 77605..78029 - 425 Protein_71 recombinase family protein -
LDO74_RS19690 (NVI2019_OGMBKCAO_03957) 78029..78562 - 534 WP_282563841.1 type-F conjugative transfer system pilin assembly protein TraF -
LDO74_RS19695 (NVI2019_OGMBKCAO_03958) 78505..78801 - 297 WP_282563840.1 hypothetical protein -
LDO74_RS21100 79156..79278 - 123 WP_263422648.1 hypothetical protein -
LDO74_RS19700 (NVI2019_OGMBKCAO_03959) 79299..79646 - 348 WP_051420173.1 ParB/Srx family N-terminal domain-containing protein -
LDO74_RS19705 (NVI2019_OGMBKCAO_03960) 79692..80903 - 1212 Protein_76 IS3 family transposase -
LDO74_RS19710 (NVI2019_OGMBKCAO_03962) 81506..82192 + 687 WP_282563839.1 AAA family ATPase -
LDO74_RS19715 (NVI2019_OGMBKCAO_03963) 82144..82422 + 279 WP_036979198.1 ribbon-helix-helix protein, CopG family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - cdtC / cdtB / cdtB / cdtA / yopJ/yopP / stcE / exeG / prgK / prgI / sicA / spaS / spaQ / spaP / invC/sctN / invA 1..171398 171398


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11028.01 Da        Isoelectric Point: 10.6508

>T294815 WP_036979529.1 NZ_OU659163:c77192-76911 [Providencia alcalifaciens]
MTYKLEFDRRALKEWQKLAPPIRNQFKKKLLERIENPCVPSAKLSGKNNRYKIKLRSLGYRLIYEVIDEKIILLVIAVGK
REGNTVYFSSNER

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9116.31 Da        Isoelectric Point: 3.7550

>AT294815 WP_036974972.1 NZ_OU659163:c77433-77182 [Providencia alcalifaciens]
MTYQILSDTAASITDLKKNPMGTIAGGEGNPVAILNRNEPAFYCVPPELFAWFMELAEDAELNKIADERLESLDVVSVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References