Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 136810..137332 | Replicon | plasmid 2 |
| Accession | NZ_OU659151 | ||
| Organism | Providencia alcalifaciens strain 2019-04-29290-1-7 isolate 2019-04-29290-1-7 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LDP49_RS19950 | Protein ID | WP_036974970.1 |
| Coordinates | 136810..137091 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LDP49_RS19955 | Protein ID | WP_036974972.1 |
| Coordinates | 137081..137332 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDP49_RS19950 (NVI2019_NGLDDFDA_03992) | 136810..137091 | - | 282 | WP_036974970.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LDP49_RS19955 (NVI2019_NGLDDFDA_03993) | 137081..137332 | - | 252 | WP_036974972.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LDP49_RS19960 (NVI2019_NGLDDFDA_03994) | 137491..138072 | - | 582 | WP_036982181.1 | recombinase family protein | - |
| LDP49_RS19965 (NVI2019_NGLDDFDA_03995) | 138442..138960 | + | 519 | WP_224120839.1 | fimbrial protein | - |
| LDP49_RS19970 (NVI2019_NGLDDFDA_03996) | 139081..139581 | + | 501 | WP_282564619.1 | fimbrial protein | - |
| LDP49_RS19975 (NVI2019_NGLDDFDA_03997) | 139697..142198 | + | 2502 | WP_224120841.1 | fimbria/pilus outer membrane usher protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgK / prgI / sicA / spaS / spaQ / spaP / invC/sctN / invA / vopT / espC / papC / espC | 1..153987 | 153987 | |
| - | flank | IS/Tn | - | - | 137491..138072 | 581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11028.01 Da Isoelectric Point: 10.6508
>T294811 WP_036974970.1 NZ_OU659151:c137091-136810 [Providencia alcalifaciens]
MTYKLEFDRRALKEWQKLAPPIRNQFKKKLLERLENPCVPSAKLSGKNNRYKIKLRSLGYRLIYEVIDEKIILLVIAVGK
REGNTVYFSSNER
MTYKLEFDRRALKEWQKLAPPIRNQFKKKLLERLENPCVPSAKLSGKNNRYKIKLRSLGYRLIYEVIDEKIILLVIAVGK
REGNTVYFSSNER
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|