Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 848116..848760 | Replicon | chromosome |
| Accession | NZ_OU659150 | ||
| Organism | Providencia alcalifaciens strain 2019-04-29290-1-7 isolate 2019-04-29290-1-7 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | B6XA97 |
| Locus tag | LDP49_RS03865 | Protein ID | WP_004905417.1 |
| Coordinates | 848116..848319 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LDP49_RS03870 | Protein ID | WP_006662760.1 |
| Coordinates | 848392..848760 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDP49_RS03845 (NVI2019_NGLDDFDA_00773) | 844006..845787 | + | 1782 | WP_036967305.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
| LDP49_RS03850 (NVI2019_NGLDDFDA_00774) | 845938..846804 | - | 867 | WP_006662762.1 | acyl-CoA thioesterase II | - |
| LDP49_RS20085 | 847211..847501 | + | 291 | WP_282558955.1 | YbaY family lipoprotein | - |
| LDP49_RS03865 (NVI2019_NGLDDFDA_00776) | 848116..848319 | - | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
| LDP49_RS03870 (NVI2019_NGLDDFDA_00777) | 848392..848760 | - | 369 | WP_006662760.1 | Hha toxicity modulator TomB | Antitoxin |
| LDP49_RS03875 (NVI2019_NGLDDFDA_00778) | 849286..850665 | - | 1380 | WP_036961894.1 | murein transglycosylase D | - |
| LDP49_RS03880 (NVI2019_NGLDDFDA_00779) | 850748..851500 | - | 753 | WP_006657234.1 | hydroxyacylglutathione hydrolase | - |
| LDP49_RS03885 (NVI2019_NGLDDFDA_00780) | 851537..852262 | + | 726 | WP_006657235.1 | methyltransferase domain-containing protein | - |
| LDP49_RS03890 (NVI2019_NGLDDFDA_00781) | 852275..852745 | - | 471 | WP_006657236.1 | ribonuclease HI | - |
| LDP49_RS03895 (NVI2019_NGLDDFDA_00782) | 852800..853561 | + | 762 | WP_006662757.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T294808 WP_004905417.1 NZ_OU659150:c848319-848116 [Providencia alcalifaciens]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14087.96 Da Isoelectric Point: 4.4687
>AT294808 WP_006662760.1 NZ_OU659150:c848760-848392 [Providencia alcalifaciens]
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|