Detailed information of TA system TA294803

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/ParE-DnaT
• Location: 122801..123323
• Replicon: plasmid 3
• Accession: NZ_OU659132
• Organism: Providencia alcalifaciens strain 2019-04-28370-1-5 isolate 2019-04-28370-1-5

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: LDO77_RS19795
• Protein ID: WP_036974970.1
• Coordinates: 123042..123323 (+)
• Length: 94 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: LDO77_RS19790
• Protein ID: WP_036974972.1
• Coordinates: 122801..123052 (+)
• Length: 84 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LDO77_RS19755 (NVI2019_OHEONHNH_03966)	117812..118090	-	279	WP_036979198.1	ribbon-helix-helix protein, CopG family	-
LDO77_RS19760 (NVI2019_OHEONHNH_03967)	118042..118728	-	687	WP_282563839.1	AAA family ATPase	-
LDO77_RS19765 (NVI2019_OHEONHNH_03969)	119331..120542	+	1212	Protein_92	IS3 family transposase	-
LDO77_RS19770 (NVI2019_OHEONHNH_03970)	120588..120935	+	348	WP_051420173.1	ParB/Srx family N-terminal domain-containing protein	-
LDO77_RS21080	120956..121078	+	123	WP_263422648.1	hypothetical protein	-
LDO77_RS19775 (NVI2019_OHEONHNH_03971)	121433..121729	+	297	WP_282563840.1	hypothetical protein	-
LDO77_RS19780 (NVI2019_OHEONHNH_03972)	121672..122205	+	534	WP_282563841.1	type-F conjugative transfer system pilin assembly protein TraF	-
LDO77_RS19785	122205..122629	+	425	Protein_97	recombinase family protein	-
LDO77_RS19790 (NVI2019_OHEONHNH_03974)	122801..123052	+	252	WP_036974972.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
LDO77_RS19795 (NVI2019_OHEONHNH_03975)	123042..123323	+	282	WP_036974970.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
LDO77_RS19800	123552..123854	+	303	Protein_100	recombinase family protein	-
LDO77_RS19810 (NVI2019_OHEONHNH_03977)	124099..124368	+	270	WP_036979554.1	plasmid partitioning/stability family protein	-
LDO77_RS19815 (NVI2019_OHEONHNH_03978)	124563..124841	+	279	WP_230087585.1	S24 family peptidase	-
LDO77_RS19820 (NVI2019_OHEONHNH_03979)	124954..126222	+	1269	WP_036979530.1	translesion error-prone DNA polymerase V subunit UmuC	-
LDO77_RS19825 (NVI2019_OHEONHNH_03980)	126429..126755	+	327	WP_036979532.1	type II toxin-antitoxin system RelE/ParE family toxin	-
LDO77_RS19830 (NVI2019_OHEONHNH_03981)	126742..127014	+	273	WP_036979555.1	helix-turn-helix transcriptional regulator	-
LDO77_RS19835 (NVI2019_OHEONHNH_03982)	127109..127318	+	210	WP_036979533.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	cdtA / cdtB / cdtB / cdtC / invA / invC/sctN / spaP / spaQ / spaS / sicA / prgI / prgK / exeG / stcE / yopJ/yopP	1..171426	171426
	-	inside	IScluster/Tn	-	-	119368..123875	4507

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (5-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 94 a.a.
• Molecular weight: 11028.01 Da
• Isoelectric Point: 10.6508

>T294803 WP_036974970.1 NZ_OU659132:123042-123323 [Providencia alcalifaciens]
MTYKLEFDRRALKEWQKLAPPIRNQFKKKLLERLENPCVPSAKLSGKNNRYKIKLRSLGYRLIYEVIDEKIILLVIAVGK
REGNTVYFSSNER

Nucleotide

• Length: 282 bp

Antitoxin

Protein

• Length: 84 a.a.
• Molecular weight: 9116.31 Da
• Isoelectric Point: 3.7550

>AT294803 WP_036974972.1 NZ_OU659132:122801-123052 [Providencia alcalifaciens]
MTYQILSDTAASITDLKKNPMGTIAGGEGNPVAILNRNEPAFYCVPPELFAWFMELAEDAELNKIADERLESLDVVSVNI
DDL

Nucleotide

• Length: 252 bp