Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 283567..284211 | Replicon | plasmid 2 |
Accession | NZ_OU659131 | ||
Organism | Providencia alcalifaciens strain 2019-04-28370-1-5 isolate 2019-04-28370-1-5 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | B6XA97 |
Locus tag | LDO77_RS18250 | Protein ID | WP_004905417.1 |
Coordinates | 283567..283770 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | LDO77_RS18255 | Protein ID | WP_006662760.1 |
Coordinates | 283843..284211 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LDO77_RS18230 (NVI2019_OHEONHNH_03663) | 279461..281242 | + | 1782 | WP_036967305.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
LDO77_RS18235 (NVI2019_OHEONHNH_03664) | 281389..282255 | - | 867 | WP_006662762.1 | acyl-CoA thioesterase II | - |
LDO77_RS18240 (NVI2019_OHEONHNH_03665) | 282527..282919 | + | 393 | Protein_271 | YbaY family lipoprotein | - |
LDO77_RS18250 (NVI2019_OHEONHNH_03666) | 283567..283770 | - | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
LDO77_RS18255 (NVI2019_OHEONHNH_03667) | 283843..284211 | - | 369 | WP_006662760.1 | Hha toxicity modulator TomB | Antitoxin |
LDO77_RS18260 (NVI2019_OHEONHNH_03668) | 284737..286116 | - | 1380 | WP_036961894.1 | murein transglycosylase D | - |
LDO77_RS18265 (NVI2019_OHEONHNH_03669) | 286172..286951 | - | 780 | WP_282565640.1 | hydroxyacylglutathione hydrolase | - |
LDO77_RS18270 (NVI2019_OHEONHNH_03670) | 286988..287713 | + | 726 | WP_006657235.1 | methyltransferase domain-containing protein | - |
LDO77_RS18275 (NVI2019_OHEONHNH_03671) | 287717..288196 | - | 480 | WP_282490043.1 | ribonuclease HI | - |
LDO77_RS18280 (NVI2019_OHEONHNH_03672) | 288251..289012 | + | 762 | WP_006662757.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | gnd / gmhA/lpcA / luxS | 1..488666 | 488666 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T294802 WP_004905417.1 NZ_OU659131:c283770-283567 [Providencia alcalifaciens]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14087.96 Da Isoelectric Point: 4.4687
>AT294802 WP_006662760.1 NZ_OU659131:c284211-283843 [Providencia alcalifaciens]
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|