Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 65976..66535 | Replicon | plasmid 3 |
| Accession | NZ_OU659122 | ||
| Organism | Providencia alcalifaciens strain 2019-04-28369-1-2 isolate 2019-04-28369-1-2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LDO76_RS20320 | Protein ID | WP_036974639.1 |
| Coordinates | 65976..66254 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LDO76_RS20325 | Protein ID | WP_282563866.1 |
| Coordinates | 66245..66535 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO76_RS20305 (NVI2019_PLFLNFOB_04080) | 61126..64020 | - | 2895 | WP_282563864.1 | conjugal transfer mating-pair stabilization protein TraG | - |
| LDO76_RS20310 (NVI2019_PLFLNFOB_04081) | 64033..65427 | - | 1395 | WP_282563883.1 | conjugal transfer pilus assembly protein TraH | - |
| LDO76_RS21260 (NVI2019_PLFLNFOB_04082) | 65833..65976 | - | 144 | WP_282563865.1 | hypothetical protein | - |
| LDO76_RS20320 (NVI2019_PLFLNFOB_04083) | 65976..66254 | - | 279 | WP_036974639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LDO76_RS20325 (NVI2019_PLFLNFOB_04084) | 66245..66535 | - | 291 | WP_282563866.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| LDO76_RS20330 (NVI2019_PLFLNFOB_04085) | 66638..67168 | - | 531 | WP_224051144.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
| LDO76_RS20335 (NVI2019_PLFLNFOB_04086) | 67174..67464 | - | 291 | WP_224051145.1 | hypothetical protein | - |
| LDO76_RS20340 (NVI2019_PLFLNFOB_04087) | 67485..68240 | - | 756 | WP_282490794.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
| LDO76_RS21265 | 68474..69415 | - | 942 | Protein_53 | conjugal transfer protein TraN | - |
| LDO76_RS20350 (NVI2019_PLFLNFOB_04089) | 70081..70716 | - | 636 | WP_282563867.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..91756 | 91756 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10909.82 Da Isoelectric Point: 9.8960
>T294793 WP_036974639.1 NZ_OU659122:c66254-65976 [Providencia alcalifaciens]
MELKWTSKALSDLSRVYDFLALSNSVAAARVVQTLTKAPMLLLIKNPRMGEQLFQFMPHEVRRIVVVNYEIRYELIDSTI
YILRIWHTREDR
MELKWTSKALSDLSRVYDFLALSNSVAAARVVQTLTKAPMLLLIKNPRMGEQLFQFMPHEVRRIVVVNYEIRYELIDSTI
YILRIWHTREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|