Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-higA/HTH_XRE(antitoxin)
Location 65833..66254 Replicon plasmid 3
Accession NZ_OU659122
Organism Providencia alcalifaciens strain 2019-04-28369-1-2 isolate 2019-04-28369-1-2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LDO76_RS20320 Protein ID WP_036974639.1
Coordinates 65976..66254 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LDO76_RS21260 Protein ID WP_282563865.1
Coordinates 65833..65976 (-) Length 48 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDO76_RS20305 (NVI2019_PLFLNFOB_04080) 61126..64020 - 2895 WP_282563864.1 conjugal transfer mating-pair stabilization protein TraG -
LDO76_RS20310 (NVI2019_PLFLNFOB_04081) 64033..65427 - 1395 WP_282563883.1 conjugal transfer pilus assembly protein TraH -
LDO76_RS21260 (NVI2019_PLFLNFOB_04082) 65833..65976 - 144 WP_282563865.1 hypothetical protein Antitoxin
LDO76_RS20320 (NVI2019_PLFLNFOB_04083) 65976..66254 - 279 WP_036974639.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LDO76_RS20325 (NVI2019_PLFLNFOB_04084) 66245..66535 - 291 WP_282563866.1 ribbon-helix-helix domain-containing protein -
LDO76_RS20330 (NVI2019_PLFLNFOB_04085) 66638..67168 - 531 WP_224051144.1 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB -
LDO76_RS20335 (NVI2019_PLFLNFOB_04086) 67174..67464 - 291 WP_224051145.1 hypothetical protein -
LDO76_RS20340 (NVI2019_PLFLNFOB_04087) 67485..68240 - 756 WP_282490794.1 type-F conjugative transfer system pilin assembly protein TraF -
LDO76_RS21265 68474..69415 - 942 Protein_53 conjugal transfer protein TraN -
LDO76_RS20350 (NVI2019_PLFLNFOB_04089) 70081..70716 - 636 WP_282563867.1 type-F conjugative transfer system pilin assembly protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..91756 91756


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10909.82 Da        Isoelectric Point: 9.8960

>T294792 WP_036974639.1 NZ_OU659122:c66254-65976 [Providencia alcalifaciens]
MELKWTSKALSDLSRVYDFLALSNSVAAARVVQTLTKAPMLLLIKNPRMGEQLFQFMPHEVRRIVVVNYEIRYELIDSTI
YILRIWHTREDR

Download         Length: 279 bp

Antitoxin


Download         Length: 48 a.a.        Molecular weight: 5122.95 Da        Isoelectric Point: 8.2941

>AT294792 WP_282563865.1 NZ_OU659122:c65976-65833 [Providencia alcalifaciens]
MRQFKVSHLGEIIARDLADMGISGRRFALNIDVTPATAGNSNCCCIR

Download         Length: 144 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References