Detailed information of TA system TA294789

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/ParE-DnaT
• Location: 122780..123302
• Replicon: plasmid 2
• Accession: NZ_OU659121
• Organism: Providencia alcalifaciens strain 2019-04-28369-1-2 isolate 2019-04-28369-1-2

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: LDO76_RS19795
• Protein ID: WP_036979529.1
• Coordinates: 123021..123302 (+)
• Length: 94 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: LDO76_RS19790
• Protein ID: WP_036974972.1
• Coordinates: 122780..123031 (+)
• Length: 84 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LDO76_RS19755 (NVI2019_PLFLNFOB_03966)	117791..118069	-	279	WP_036979198.1	ribbon-helix-helix protein, CopG family	-
LDO76_RS19760 (NVI2019_PLFLNFOB_03967)	118021..118707	-	687	WP_282563839.1	AAA family ATPase	-
LDO76_RS19765 (NVI2019_PLFLNFOB_03969)	119310..120521	+	1212	Protein_90	IS3 family transposase	-
LDO76_RS19770 (NVI2019_PLFLNFOB_03970)	120567..120914	+	348	WP_051420173.1	ParB/Srx family N-terminal domain-containing protein	-
LDO76_RS21080	120935..121057	+	123	WP_263422648.1	hypothetical protein	-
LDO76_RS19775 (NVI2019_PLFLNFOB_03971)	121412..121708	+	297	WP_282563840.1	hypothetical protein	-
LDO76_RS19780 (NVI2019_PLFLNFOB_03972)	121651..122184	+	534	WP_282563841.1	type-F conjugative transfer system pilin assembly protein TraF	-
LDO76_RS19785	122184..122608	+	425	Protein_95	recombinase family protein	-
LDO76_RS19790 (NVI2019_PLFLNFOB_03974)	122780..123031	+	252	WP_036974972.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
LDO76_RS19795 (NVI2019_PLFLNFOB_03975)	123021..123302	+	282	WP_036979529.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
LDO76_RS19800	123531..123833	+	303	Protein_98	recombinase family protein	-
LDO76_RS19810 (NVI2019_PLFLNFOB_03977)	124078..124347	+	270	WP_036979554.1	plasmid partitioning/stability family protein	-
LDO76_RS19815 (NVI2019_PLFLNFOB_03978)	124542..124820	+	279	WP_230087585.1	S24 family peptidase	-
LDO76_RS19820 (NVI2019_PLFLNFOB_03979)	124933..126201	+	1269	WP_036979530.1	translesion error-prone DNA polymerase V subunit UmuC	-
LDO76_RS19825 (NVI2019_PLFLNFOB_03980)	126408..126734	+	327	WP_036979532.1	type II toxin-antitoxin system RelE/ParE family toxin	-
LDO76_RS19830 (NVI2019_PLFLNFOB_03981)	126721..126993	+	273	WP_036979555.1	helix-turn-helix transcriptional regulator	-
LDO76_RS19835 (NVI2019_PLFLNFOB_03982)	127088..127297	+	210	WP_036979533.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	cdtA / cdtB / cdtB / cdtC / invA / invC/sctN / spaP / spaQ / spaS / sicA / prgI / prgK / exeG / stcE / yopJ/yopP	1..171405	171405

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (5-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 94 a.a.
• Molecular weight: 11028.01 Da
• Isoelectric Point: 10.6508

>T294789 WP_036979529.1 NZ_OU659121:123021-123302 [Providencia alcalifaciens]
MTYKLEFDRRALKEWQKLAPPIRNQFKKKLLERIENPCVPSAKLSGKNNRYKIKLRSLGYRLIYEVIDEKIILLVIAVGK
REGNTVYFSSNER

Nucleotide

• Length: 282 bp

Antitoxin

Protein

• Length: 84 a.a.
• Molecular weight: 9116.31 Da
• Isoelectric Point: 3.7550

>AT294789 WP_036974972.1 NZ_OU659121:122780-123031 [Providencia alcalifaciens]
MTYQILSDTAASITDLKKNPMGTIAGGEGNPVAILNRNEPAFYCVPPELFAWFMELAEDAELNKIADERLESLDVVSVNI
DDL

Nucleotide

• Length: 252 bp