Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3161380..3162024 | Replicon | chromosome |
Accession | NZ_OU659120 | ||
Organism | Providencia alcalifaciens strain 2019-04-28369-1-2 isolate 2019-04-28369-1-2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | B6XA97 |
Locus tag | LDO76_RS15135 | Protein ID | WP_004905417.1 |
Coordinates | 3161821..3162024 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | LDO76_RS15130 | Protein ID | WP_006662760.1 |
Coordinates | 3161380..3161748 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LDO76_RS15105 (NVI2019_PLFLNFOB_03032) | 3156579..3157340 | - | 762 | WP_006662757.1 | DNA polymerase III subunit epsilon | - |
LDO76_RS15110 (NVI2019_PLFLNFOB_03033) | 3157395..3157865 | + | 471 | WP_006657236.1 | ribonuclease HI | - |
LDO76_RS15115 (NVI2019_PLFLNFOB_03034) | 3157878..3158603 | - | 726 | WP_006657235.1 | methyltransferase domain-containing protein | - |
LDO76_RS15120 (NVI2019_PLFLNFOB_03035) | 3158640..3159392 | + | 753 | WP_224050830.1 | hydroxyacylglutathione hydrolase | - |
LDO76_RS15125 (NVI2019_PLFLNFOB_03036) | 3159475..3160854 | + | 1380 | WP_036961894.1 | murein transglycosylase D | - |
LDO76_RS15130 (NVI2019_PLFLNFOB_03037) | 3161380..3161748 | + | 369 | WP_006662760.1 | Hha toxicity modulator TomB | Antitoxin |
LDO76_RS15135 (NVI2019_PLFLNFOB_03038) | 3161821..3162024 | + | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
LDO76_RS21205 | 3162639..3162929 | - | 291 | WP_282563797.1 | YbaY family lipoprotein | - |
LDO76_RS15150 (NVI2019_PLFLNFOB_03040) | 3163336..3164202 | + | 867 | WP_006662762.1 | acyl-CoA thioesterase II | - |
LDO76_RS15155 (NVI2019_PLFLNFOB_03041) | 3164349..3166130 | - | 1782 | WP_036967305.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T294788 WP_004905417.1 NZ_OU659120:3161821-3162024 [Providencia alcalifaciens]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14087.96 Da Isoelectric Point: 4.4687
>AT294788 WP_006662760.1 NZ_OU659120:3161380-3161748 [Providencia alcalifaciens]
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|