294785

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 41323..41845 Replicon plasmid 2
Accession NZ_OU659119
Organism Providencia alcalifaciens strain 2019-01-3283-1-1 isolate 2019-01-3283-1-1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LDO75_RS18615 Protein ID WP_036979529.1
Coordinates 41564..41845 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag LDO75_RS18610 Protein ID WP_036974972.1
Coordinates 41323..41574 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDO75_RS18580 (NVI2019_PEGOAJLN_03734) 36484..37170 - 687 WP_282563839.1 AAA family ATPase -
LDO75_RS18585 (NVI2019_PEGOAJLN_03736) 37853..39064 + 1212 Protein_25 IS3 family transposase -
LDO75_RS18590 (NVI2019_PEGOAJLN_03737) 39110..39457 + 348 WP_051420173.1 ParB/Srx family N-terminal domain-containing protein -
LDO75_RS19245 39478..39600 + 123 WP_263422648.1 hypothetical protein -
LDO75_RS18595 (NVI2019_PEGOAJLN_03738) 39955..40251 + 297 WP_282564482.1 hypothetical protein -
LDO75_RS18600 (NVI2019_PEGOAJLN_03739) 40194..40727 + 534 WP_282563841.1 type-F conjugative transfer system pilin assembly protein TraF -
LDO75_RS18605 40727..41151 + 425 Protein_30 recombinase family protein -
LDO75_RS18610 (NVI2019_PEGOAJLN_03741) 41323..41574 + 252 WP_036974972.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LDO75_RS18615 (NVI2019_PEGOAJLN_03742) 41564..41845 + 282 WP_036979529.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LDO75_RS18620 42074..42376 + 303 Protein_33 recombinase family protein -
LDO75_RS18630 (NVI2019_PEGOAJLN_03744) 42621..42890 + 270 WP_036979554.1 plasmid partitioning/stability family protein -
LDO75_RS18635 (NVI2019_PEGOAJLN_03745) 43085..43363 + 279 WP_230087585.1 S24 family peptidase -
LDO75_RS18640 (NVI2019_PEGOAJLN_03746) 43476..44744 + 1269 WP_224063847.1 translesion error-prone DNA polymerase V subunit UmuC -
LDO75_RS18645 (NVI2019_PEGOAJLN_03747) 44951..45277 + 327 WP_036979532.1 type II toxin-antitoxin system RelE/ParE family toxin -
LDO75_RS18650 (NVI2019_PEGOAJLN_03748) 45264..45536 + 273 WP_036979555.1 helix-turn-helix transcriptional regulator -
LDO75_RS18655 (NVI2019_PEGOAJLN_03749) 45631..45840 + 210 WP_036979533.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - yopJ/yopP / stcE / exeG / cdtB / cdtB / cdtC / invA / invC/sctN / spaP / spaQ / spaS / sicA / prgI / prgK 1..168972 168972
- inside IScluster/Tn - - 37890..42397 4507


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11028.01 Da        Isoelectric Point: 10.6508

>T294785 WP_036979529.1 NZ_OU659119:41564-41845 [Providencia alcalifaciens]
MTYKLEFDRRALKEWQKLAPPIRNQFKKKLLERIENPCVPSAKLSGKNNRYKIKLRSLGYRLIYEVIDEKIILLVIAVGK
REGNTVYFSSNER

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9116.31 Da        Isoelectric Point: 3.7550

>AT294785 WP_036974972.1 NZ_OU659119:41323-41574 [Providencia alcalifaciens]
MTYQILSDTAASITDLKKNPMGTIAGGEGNPVAILNRNEPAFYCVPPELFAWFMELAEDAELNKIADERLESLDVVSVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References