Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 122031..122553 Replicon plasmid 2
Accession NZ_OU659114
Organism Providencia alcalifaciens strain 2019-04-27799-1-2 isolate 2019-04-27799-1-2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LDO34_RS19780 Protein ID WP_036979529.1
Coordinates 122272..122553 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag LDO34_RS19775 Protein ID WP_036974972.1
Coordinates 122031..122282 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDO34_RS19740 (NVI2019_KOLGMIGM_03968) 117042..117320 - 279 WP_036979198.1 ribbon-helix-helix protein, CopG family -
LDO34_RS19745 (NVI2019_KOLGMIGM_03969) 117272..117958 - 687 WP_282563839.1 AAA family ATPase -
LDO34_RS19750 (NVI2019_KOLGMIGM_03971) 118561..119772 + 1212 Protein_92 IS3 family transposase -
LDO34_RS19755 (NVI2019_KOLGMIGM_03972) 119818..120165 + 348 WP_051420173.1 ParB/Srx family N-terminal domain-containing protein -
LDO34_RS21070 120186..120308 + 123 WP_263422648.1 hypothetical protein -
LDO34_RS19760 (NVI2019_KOLGMIGM_03973) 120663..120959 + 297 WP_282563840.1 hypothetical protein -
LDO34_RS19765 (NVI2019_KOLGMIGM_03974) 120902..121435 + 534 WP_282563841.1 type-F conjugative transfer system pilin assembly protein TraF -
LDO34_RS19770 121435..121859 + 425 Protein_97 recombinase family protein -
LDO34_RS19775 (NVI2019_KOLGMIGM_03976) 122031..122282 + 252 WP_036974972.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LDO34_RS19780 (NVI2019_KOLGMIGM_03977) 122272..122553 + 282 WP_036979529.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LDO34_RS19785 122782..123084 + 303 Protein_100 recombinase family protein -
LDO34_RS19795 (NVI2019_KOLGMIGM_03979) 123329..123598 + 270 WP_036979554.1 plasmid partitioning/stability family protein -
LDO34_RS19800 (NVI2019_KOLGMIGM_03980) 123793..124071 + 279 WP_230087585.1 S24 family peptidase -
LDO34_RS19805 (NVI2019_KOLGMIGM_03981) 124184..125452 + 1269 WP_036979530.1 translesion error-prone DNA polymerase V subunit UmuC -
LDO34_RS19810 (NVI2019_KOLGMIGM_03982) 125659..125985 + 327 WP_036979532.1 type II toxin-antitoxin system RelE/ParE family toxin -
LDO34_RS19815 (NVI2019_KOLGMIGM_03983) 125972..126244 + 273 WP_036979555.1 helix-turn-helix transcriptional regulator -
LDO34_RS19820 (NVI2019_KOLGMIGM_03984) 126339..126548 + 210 WP_036979533.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - cdtA / cdtB / cdtB / cdtC / invA / invC/sctN / spaP / spaQ / spaS / sicA / prgI / prgK / exeG / stcE / yopJ/yopP 1..170656 170656
- inside IScluster/Tn - - 118598..123105 4507


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11028.01 Da        Isoelectric Point: 10.6508

>T294777 WP_036979529.1 NZ_OU659114:122272-122553 [Providencia alcalifaciens]
MTYKLEFDRRALKEWQKLAPPIRNQFKKKLLERIENPCVPSAKLSGKNNRYKIKLRSLGYRLIYEVIDEKIILLVIAVGK
REGNTVYFSSNER

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9116.31 Da        Isoelectric Point: 3.7550

>AT294777 WP_036974972.1 NZ_OU659114:122031-122282 [Providencia alcalifaciens]
MTYQILSDTAASITDLKKNPMGTIAGGEGNPVAILNRNEPAFYCVPPELFAWFMELAEDAELNKIADERLESLDVVSVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References