Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2845586..2846243 | Replicon | chromosome |
| Accession | NZ_OU659113 | ||
| Organism | Providencia alcalifaciens strain 2019-04-27799-1-2 isolate 2019-04-27799-1-2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | LDO34_RS13790 | Protein ID | WP_006661186.1 |
| Coordinates | 2845586..2845996 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | LDO34_RS13795 | Protein ID | WP_036964213.1 |
| Coordinates | 2845977..2846243 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO34_RS13770 (NVI2019_KOLGMIGM_02771) | 2841560..2843293 | - | 1734 | WP_036968251.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LDO34_RS13775 (NVI2019_KOLGMIGM_02772) | 2843302..2844003 | - | 702 | WP_006658051.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LDO34_RS13780 (NVI2019_KOLGMIGM_02773) | 2844022..2844924 | - | 903 | WP_224050460.1 | site-specific tyrosine recombinase XerD | - |
| LDO34_RS13785 (NVI2019_KOLGMIGM_02774) | 2845042..2845560 | + | 519 | WP_006658049.1 | flavodoxin FldB | - |
| LDO34_RS13790 (NVI2019_KOLGMIGM_02775) | 2845586..2845996 | - | 411 | WP_006661186.1 | protein YgfX | Toxin |
| LDO34_RS13795 (NVI2019_KOLGMIGM_02776) | 2845977..2846243 | - | 267 | WP_036964213.1 | FAD assembly factor SdhE | Antitoxin |
| LDO34_RS13800 (NVI2019_KOLGMIGM_02777) | 2846535..2847521 | + | 987 | WP_036968245.1 | tRNA-modifying protein YgfZ | - |
| LDO34_RS13805 (NVI2019_KOLGMIGM_02778) | 2847533..2848153 | + | 621 | WP_224050461.1 | HD domain-containing protein | - |
| LDO34_RS13810 (NVI2019_KOLGMIGM_02779) | 2848241..2851117 | - | 2877 | WP_224050462.1 | aminomethyl-transferring glycine dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15437.35 Da Isoelectric Point: 10.6963
>T294776 WP_006661186.1 NZ_OU659113:c2845996-2845586 [Providencia alcalifaciens]
VVLWKSNLSISWKTQLFSTSLHVGAGIILLVAPWEPGNSMIWLPLLVILVASWAKSQKNISKVKGVAVLVNGNKLQWKKN
EWEIIKAPWCSRCGILLTLKALQGKPQKLRLWVAKDSVSEENWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTSLHVGAGIILLVAPWEPGNSMIWLPLLVILVASWAKSQKNISKVKGVAVLVNGNKLQWKKN
EWEIIKAPWCSRCGILLTLKALQGKPQKLRLWVAKDSVSEENWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|