Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 853414..854058 | Replicon | chromosome |
Accession | NZ_OU659113 | ||
Organism | Providencia alcalifaciens strain 2019-04-27799-1-2 isolate 2019-04-27799-1-2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | B6XA97 |
Locus tag | LDO34_RS03880 | Protein ID | WP_004905417.1 |
Coordinates | 853414..853617 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | LDO34_RS03885 | Protein ID | WP_006662760.1 |
Coordinates | 853690..854058 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LDO34_RS03860 (NVI2019_KOLGMIGM_00776) | 849308..851089 | + | 1782 | WP_036967305.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
LDO34_RS03865 (NVI2019_KOLGMIGM_00777) | 851236..852102 | - | 867 | WP_006662762.1 | acyl-CoA thioesterase II | - |
LDO34_RS21125 | 852509..852799 | + | 291 | WP_282563797.1 | YbaY family lipoprotein | - |
LDO34_RS03880 (NVI2019_KOLGMIGM_00779) | 853414..853617 | - | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
LDO34_RS03885 (NVI2019_KOLGMIGM_00780) | 853690..854058 | - | 369 | WP_006662760.1 | Hha toxicity modulator TomB | Antitoxin |
LDO34_RS03890 (NVI2019_KOLGMIGM_00781) | 854584..855963 | - | 1380 | WP_036961894.1 | murein transglycosylase D | - |
LDO34_RS03895 (NVI2019_KOLGMIGM_00782) | 856046..856798 | - | 753 | WP_224050830.1 | hydroxyacylglutathione hydrolase | - |
LDO34_RS03900 (NVI2019_KOLGMIGM_00783) | 856835..857560 | + | 726 | WP_006657235.1 | methyltransferase domain-containing protein | - |
LDO34_RS03905 (NVI2019_KOLGMIGM_00784) | 857573..858043 | - | 471 | WP_006657236.1 | ribonuclease HI | - |
LDO34_RS03910 (NVI2019_KOLGMIGM_00785) | 858098..858859 | + | 762 | WP_006662757.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T294775 WP_004905417.1 NZ_OU659113:c853617-853414 [Providencia alcalifaciens]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14087.96 Da Isoelectric Point: 4.4687
>AT294775 WP_006662760.1 NZ_OU659113:c854058-853690 [Providencia alcalifaciens]
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|