Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YefM-YoeB |
| Location | 1545603..1546108 | Replicon | chromosome |
| Accession | NZ_OU594967 | ||
| Organism | Celerinatantimonas diazotrophica isolate CEDIAZO1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LDO33_RS07250 | Protein ID | WP_131913120.1 |
| Coordinates | 1545603..1545857 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LDO33_RS07255 | Protein ID | WP_131912901.1 |
| Coordinates | 1545854..1546108 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO33_RS07225 (CEDIAZO_01449) | 1541186..1541695 | + | 510 | WP_165872726.1 | SCP2 sterol-binding domain-containing protein | - |
| LDO33_RS07230 (CEDIAZO_01450) | 1541692..1542840 | - | 1149 | WP_131912905.1 | DUF945 family protein | - |
| LDO33_RS07235 (CEDIAZO_01451) | 1542867..1543133 | - | 267 | WP_131912904.1 | YfhL family 4Fe-4S dicluster ferredoxin | - |
| LDO33_RS07240 (CEDIAZO_01452) | 1543781..1544698 | + | 918 | WP_131912903.1 | hypothetical protein | - |
| LDO33_RS07245 (CEDIAZO_01454) | 1545031..1545408 | + | 378 | WP_131912902.1 | hypothetical protein | - |
| LDO33_RS07250 (CEDIAZO_01455) | 1545603..1545857 | + | 255 | WP_131913120.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Toxin |
| LDO33_RS07255 (CEDIAZO_01456) | 1545854..1546108 | + | 255 | WP_131912901.1 | Txe/YoeB family addiction module toxin | Antitoxin |
| LDO33_RS07260 (CEDIAZO_01457) | 1546310..1547461 | - | 1152 | WP_131912900.1 | hypothetical protein | - |
| LDO33_RS07265 | 1548753..1548974 | + | 222 | WP_131912899.1 | hypothetical protein | - |
| LDO33_RS07270 | 1549005..1549349 | + | 345 | Protein_1411 | ORF6N domain-containing protein | - |
| LDO33_RS07275 (CEDIAZO_01459) | 1549990..1550301 | - | 312 | WP_131912898.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9331.50 Da Isoelectric Point: 4.5972
>T294773 WP_131913120.1 NZ_OU594967:1545603-1545857 [Celerinatantimonas diazotrophica]
MDVMSYSQFRAQLAKTLDDVNDDHKPVMITRQNGKPAIVMSVEDFKAYEETAYLMASPKNAQRLNAAISELEGGHGSEKG
LIEE
MDVMSYSQFRAQLAKTLDDVNDDHKPVMITRQNGKPAIVMSVEDFKAYEETAYLMASPKNAQRLNAAISELEGGHGSEKG
LIEE
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|