Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4922349..4922865 | Replicon | chromosome |
Accession | NZ_OU453210 | ||
Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | K3775_RS24085 | Protein ID | WP_009486548.1 |
Coordinates | 4922349..4922633 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | K3775_RS24090 | Protein ID | WP_002886901.1 |
Coordinates | 4922623..4922865 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K3775_RS24060 (4917766) | 4917766..4918074 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
K3775_RS24065 (4918159) | 4918159..4918332 | + | 174 | WP_032433782.1 | hypothetical protein | - |
K3775_RS24070 (4918335) | 4918335..4919078 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
K3775_RS24075 (4919435) | 4919435..4921573 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
K3775_RS24080 (4921881) | 4921881..4922345 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
K3775_RS24085 (4922349) | 4922349..4922633 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K3775_RS24090 (4922623) | 4922623..4922865 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
K3775_RS24095 (4922943) | 4922943..4924853 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
K3775_RS24100 (4924876) | 4924876..4926030 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
K3775_RS24105 (4926097) | 4926097..4926837 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T294769 WP_009486548.1 NZ_OU453210:c4922633-4922349 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |