Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3987170..3987789 Replicon chromosome
Accession NZ_OU453210
Organism Klebsiella pneumoniae isolate Klebsiella pneumoniae

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag K3775_RS19615 Protein ID WP_002892050.1
Coordinates 3987571..3987789 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag K3775_RS19610 Protein ID WP_002892066.1
Coordinates 3987170..3987544 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K3775_RS19600 (3982322) 3982322..3983515 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
K3775_RS19605 (3983538) 3983538..3986684 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
K3775_RS19610 (3987170) 3987170..3987544 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
K3775_RS19615 (3987571) 3987571..3987789 + 219 WP_002892050.1 HHA domain-containing protein Toxin
K3775_RS19620 (3987952) 3987952..3988518 + 567 WP_002892030.1 maltose O-acetyltransferase -
K3775_RS19625 (3988490) 3988490..3988630 - 141 WP_004147370.1 hypothetical protein -
K3775_RS19630 (3988651) 3988651..3989121 + 471 WP_020802585.1 YlaC family protein -
K3775_RS19635 (3989096) 3989096..3990547 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
K3775_RS19640 (3990648) 3990648..3991346 + 699 WP_023287311.1 GNAT family protein -
K3775_RS19645 (3991343) 3991343..3991483 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
K3775_RS19650 (3991483) 3991483..3991746 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T294766 WP_002892050.1 NZ_OU453210:3987571-3987789 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT294766 WP_002892066.1 NZ_OU453210:3987170-3987544 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References