Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1523571..1524307 | Replicon | chromosome |
Accession | NZ_OU453210 | ||
Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | K3775_RS07630 | Protein ID | WP_032433360.1 |
Coordinates | 1523825..1524307 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | K3775_RS07625 | Protein ID | WP_003026799.1 |
Coordinates | 1523571..1523837 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K3775_RS07600 (1519217) | 1519217..1520356 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
K3775_RS07605 (1520385) | 1520385..1521047 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
K3775_RS07610 (1521031) | 1521031..1522035 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
K3775_RS07615 (1522053) | 1522053..1522685 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
K3775_RS07620 (1522695) | 1522695..1523258 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
K3775_RS07625 (1523571) | 1523571..1523837 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
K3775_RS07630 (1523825) | 1523825..1524307 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
K3775_RS07635 (1524507) | 1524507..1525910 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
K3775_RS07640 (1525939) | 1525939..1526571 | - | 633 | WP_001567369.1 | hypothetical protein | - |
K3775_RS07645 (1526951) | 1526951..1527550 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
K3775_RS07650 (1527763) | 1527763..1528707 | - | 945 | WP_077254249.1 | fimbrial protein | - |
K3775_RS07655 (1528719) | 1528719..1529297 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1491516..1537534 | 46018 | |
- | flank | IS/Tn | - | - | 1524507..1525910 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T294760 WP_032433360.1 NZ_OU453210:1523825-1524307 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |