Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1506880..1507523 | Replicon | chromosome |
Accession | NZ_OU453210 | ||
Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | K3775_RS07535 | Protein ID | WP_032433387.1 |
Coordinates | 1507107..1507523 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | K3775_RS07530 | Protein ID | WP_001261276.1 |
Coordinates | 1506880..1507110 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K3775_RS07515 (1501902) | 1501902..1502989 | + | 1088 | Protein_1471 | transcriptional regulator | - |
K3775_RS07520 (1502992) | 1502992..1505232 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
K3775_RS07525 (1505760) | 1505760..1506575 | - | 816 | WP_032433388.1 | hypothetical protein | - |
K3775_RS07530 (1506880) | 1506880..1507110 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
K3775_RS07535 (1507107) | 1507107..1507523 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
K3775_RS07540 (1507679) | 1507679..1508659 | + | 981 | WP_032433385.1 | hypothetical protein | - |
K3775_RS07545 (1508854) | 1508854..1510425 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
K3775_RS07550 (1510744) | 1510744..1510992 | + | 249 | WP_032433382.1 | hypothetical protein | - |
K3775_RS07555 (1511051) | 1511051..1511569 | + | 519 | WP_045326794.1 | hypothetical protein | - |
K3775_RS07560 (1511600) | 1511600..1512091 | + | 492 | WP_032433378.1 | hypothetical protein | - |
K3775_RS07565 (1512151) | 1512151..1512354 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1491516..1537534 | 46018 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T294759 WP_032433387.1 NZ_OU453210:1507107-1507523 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |