Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 851485..852142 | Replicon | chromosome |
| Accession | NZ_OU453210 | ||
| Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | K3775_RS04295 | Protein ID | WP_002916310.1 |
| Coordinates | 851732..852142 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | K3775_RS04290 | Protein ID | WP_002916312.1 |
| Coordinates | 851485..851751 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K3775_RS04265 (846641) | 846641..848074 | - | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
| K3775_RS04270 (848193) | 848193..848921 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| K3775_RS04275 (848971) | 848971..849282 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| K3775_RS04280 (849446) | 849446..850105 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| K3775_RS04285 (850256) | 850256..851239 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| K3775_RS04290 (851485) | 851485..851751 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| K3775_RS04295 (851732) | 851732..852142 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| K3775_RS04300 (852149) | 852149..852670 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| K3775_RS04305 (852771) | 852771..853667 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| K3775_RS04310 (853690) | 853690..854403 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| K3775_RS04315 (854409) | 854409..856142 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T294758 WP_002916310.1 NZ_OU453210:851732-852142 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |