Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 38893..39696 | Replicon | plasmid 2 |
Accession | NZ_OU342920 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A0K3X5E3 |
Locus tag | LIX80_RS24330 | Protein ID | WP_000348884.1 |
Coordinates | 38893..39423 (-) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | G3CAI7 |
Locus tag | LIX80_RS24335 | Protein ID | WP_001275013.1 |
Coordinates | 39427..39696 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS24300 (34146) | 34146..35099 | + | 954 | WP_001068902.1 | ferric citrate uptake sigma factor regulator FecR | - |
LIX80_RS24305 (35186) | 35186..37510 | + | 2325 | WP_021534628.1 | TonB-dependent Fe(3+) dicitrate receptor FecA | - |
LIX80_RS24310 (37555) | 37555..37642 | + | 88 | Protein_50 | hypothetical protein | - |
LIX80_RS24315 (37713) | 37713..37985 | + | 273 | WP_000019163.1 | hypothetical protein | - |
LIX80_RS24320 (37966) | 37966..38616 | + | 651 | Protein_52 | transposase zinc-binding domain-containing protein | - |
LIX80_RS24325 (38675) | 38675..38892 | - | 218 | Protein_53 | transposase | - |
LIX80_RS24330 (38893) | 38893..39423 | - | 531 | WP_000348884.1 | GNAT family N-acetyltransferase | Toxin |
LIX80_RS24335 (39427) | 39427..39696 | - | 270 | WP_001275013.1 | DUF1778 domain-containing protein | Antitoxin |
LIX80_RS24340 (40584) | 40584..41574 | + | 991 | Protein_56 | RepB family plasmid replication initiator protein | - |
LIX80_RS24345 (41857) | 41857..42597 | - | 741 | WP_021534629.1 | tyrosine-type recombinase/integrase | - |
LIX80_RS24350 (42718) | 42718..42852 | - | 135 | Protein_58 | serine/threonine protein kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..66803 | 66803 | |
- | flank | IS/Tn | - | - | 37966..38331 | 365 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20320.22 Da Isoelectric Point: 6.7486
>T294754 WP_000348884.1 NZ_OU342920:c39423-38893 [Escherichia coli]
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEVLFEVNDE
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEVLFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K3X5E3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G3CAI7 |